KEGG   Homo sapiens (human): 25875
Entry
25875             CDS       T01001                                 

Gene name
LETMD1, 1110019O13Rik, HCCR, HCCR-1, HCCR-2, HCCR1, HCCR2, HCRR-2, SLC55A3
Definition
(RefSeq) LETM1 domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: LETM1
Other DBs
NCBI-GeneID: 25875
NCBI-ProteinID: NP_056231
OMIM: 619070
HGNC: 24241
Ensembl: ENSG00000050426
Vega: OTTHUMG00000169538
Pharos: Q6P1Q0(Tbio)
UniProt: Q6P1Q0 A0A384P5D7
Position
12q13.12
AA seq 360 aa
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYV
VTKTKAINGKYHRFLGRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIKFHQL
PYREMEHLRQFRQDVTKCLFLGIISIPPFANYLVFLLMYLFPRQLLIRHFWTPKQQTDFL
DIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRGTHPAIHDILALRECFS
NHPLGMNQLQALHVKALSRAMLLTSYLPPPLLRHRLKTHTTVIHQLDKALAKLGIGQLTA
QEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHNVVLLSTNYLGTRR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcgctctccagggtgtgctgggctcggtcggctgtgtggggctcggcagtcacccct
ggacattttgtcacccggaggctgcaacttggtcgctctggcctggcttggggggcccct
cggtcttcaaagcttcacctttctccaaaggcagatgtgaagaacttgatgtcttatgtg
gtaaccaagacaaaagcgattaatgggaaataccatcgtttcttgggtcgtcatttcccc
cgcttctatgtcctgtacacaatcttcatgaaaggattgcagatgttatgggctgatgcc
aaaaaggctagaagaataaagacaaatatgtggaagcacaatataaagtttcatcaactt
ccataccgggagatggagcatttgagacagttccgccaagacgtcaccaagtgtcttttc
ctaggtattatttccattccaccttttgccaactacctggtcttcttgctaatgtacctg
tttcccaggcaactactgatcaggcatttctggaccccaaaacaacaaactgatttctta
gatatctatcatgctttccggaagcagtcccacccagaaattattagttatttagaaaag
gtcatccctctcatttctgatgcaggactccggtggcgtctgacagatctgtgcaccaag
atacagcgtggtacccacccagcaatacatgatatcttggctctgagagagtgtttctct
aaccatcctctgggcatgaaccaactccaggctttgcacgtgaaagccttgagccgggcc
atgcttctcacatcttacctgcctcctcccttgttgagacatcgtttgaagactcataca
actgtgattcaccaactggacaaggctttggcaaagctggggattggccagctgactgct
caggaagtaaaatcggcttgttatctccgtggcctgaattctacgcatattggtgaagat
aggtgtcgaacttggctgggagaatggctgcagatttcctgcagcctgaaagaagctgag
ctgtctctcttgctgcacaacgtggtcctgctctccaccaactaccttgggacaaggcgc
tga

DBGET integrated database retrieval system