KEGG   Homo sapiens (human): 25880Help
Entry
25880             CDS       T01001                                 

Gene name
TMEM186, C16orf51
Definition
(RefSeq) transmembrane protein 186
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM223
Motif
Other DBs
NCBI-GeneID: 25880
NCBI-ProteinID: NP_056236
HGNC: 24530
Ensembl: ENSG00000184857
Vega: OTTHUMG00000129696
Pharos: Q96B77(Tdark)
UniProt: Q96B77
Position
16p13.2
AA seq 213 aa AA seqDB search
MAALLRAVRRFRGKAVWERPLHGLWCCSGQEDPKRWVGSSSPISKEKLPNAETEKFWMFY
RFDAIRTFGFLSRLKLAQTALTVVALPPGYYLYSQGLLTLNTVCLMSGISGFALTMLCWM
SYFLRRLVGILYLNESGTMLRVAHLNFWGWRQDTYCPMADVIPLTETKDRPQEMFVRIQR
YSGKQTFYVTLRYGRILDRERFTQVFGVHQMLK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttctccgagctgtgcgtaggtttcggggaaaagctgtgtgggaaaggcct
ctccatgggctgtggtgctgcagtgggcaggaggatcctaagaggtgggtgggcagcagt
tcacccatctcgaaggagaaactaccaaacgcagagactgagaaattctggatgttttac
cgttttgatgccatcagaaccttcgggttcctgtcacgactgaagttggcacagactgcc
ctgacagtggtagctttgccaccaggctattacttgtactcccagggcctcctcactctc
aacaccgtgtgcctcatgagtgggatatcgggctttgccctgaccatgctgtgctggatg
agctatttcttacggagactggttggtatcctgtatctgaatgagtctggcaccatgctg
cgggtggcccatctgaacttctggggctggcggcaggacacatactgtcccatggcagat
gtgattcccctgacagaaaccaaggaccggcctcaggagatgtttgtgcgtatccagcgg
tacagtgggaaacagaccttctacgtcaccctgcgctatggacgcatcctggacagagag
cgtttcacacaggtgtttggggtacatcagatgctcaagtga

DBGET integrated database retrieval system