KEGG   Homo sapiens (human): 259
Entry
259               CDS       T01001                                 
Symbol
AMBP, A1M, EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI
Name
(RefSeq) alpha-1-microglobulin/bikunin precursor
  KO
K23620  protein AMBP
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    259 (AMBP)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   259 (AMBP)
SSDB
Motif
Pfam: Kunitz_BPTI Lipocalin
Other DBs
NCBI-GeneID: 259
NCBI-ProteinID: NP_001624
OMIM: 176870
HGNC: 453
Ensembl: ENSG00000106927
Pharos: P02760(Tbio)
UniProt: P02760
Structure
Position
9:complement(114060127..114078300)
AA seq 352 aa
MRSLGALLLLLSACLAVSAGPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIM
DRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMES
YVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIF
TMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPC
MGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFI
QLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaggagcctcggggccctgctcttgctgctgagcgcctgcctggcggtgagcgctggc
cctgtgccaacgccgcccgacaacatccaagtgcaggaaaacttcaatatctctcggatc
tatgggaagtggtacaacctggccatcggttccacctgcccctggctgaagaagatcatg
gacaggatgacagtgagcacgctggtgctgggagagggcgctacagaggcggagatcagc
atgaccagcactcgttggcggaaaggtgtctgtgaggagacgtctggagcttatgagaaa
acagatactgatgggaagtttctctatcacaaatccaaatggaacataaccatggagtcc
tatgtggtccacaccaactatgatgagtatgccattttcctgaccaagaaattcagccgc
catcatggacccaccattactgccaagctctacgggcgggcgccgcagctgagggaaact
ctcctgcaggacttcagagtggttgcccagggtgtgggcatccctgaggactccatcttc
accatggctgaccgaggtgaatgtgtccctggggagcaggaaccagagcccatcttaatc
ccgagagtccggagggctgtgctaccccaagaagaggaaggatcagggggtgggcaactg
gtaactgaagtcaccaagaaagaagattcctgccagctgggctactcggccggtccctgc
atgggaatgaccagcaggtatttctataatggtacatccatggcctgtgagactttccag
tacggcggctgcatgggcaacggtaacaacttcgtcacagaaaaggagtgtctgcagacc
tgccgaactgtggcggcctgcaatctccccatagtccggggcccctgccgagccttcatc
cagctctgggcatttgatgctgtcaaggggaagtgcgtcctcttcccctacgggggctgc
cagggcaacgggaacaagttctactcagagaaggagtgcagagagtactgcggtgtccct
ggtgatggtgatgaggagctgctgcgcttctccaactga

DBGET integrated database retrieval system