KEGG   Homo sapiens (human): 25904
Entry
25904             CDS       T01001                                 

Symbol
CNOT10
Name
(RefSeq) CCR4-NOT transcription complex subunit 10
  KO
K12607  CCR4-NOT transcription complex subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    25904 (CNOT10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    25904 (CNOT10)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     25904 (CNOT10)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_12 TPR_19 SRP_TPR_like TPR_14 TPR_7 TPR_10 TPR_8 TPR_MalT Uricase DUF948
Other DBs
NCBI-GeneID: 25904
NCBI-ProteinID: NP_056257
HGNC: 23817
Ensembl: ENSG00000182973
Vega: OTTHUMG00000130748
Pharos: Q9H9A5(Tdark)
UniProt: Q9H9A5
Position
3p22.3
AA seq 744 aa
MAADKPADQGAEKHEGTGQSSGITDQEKELSTNAFQAFTSGNYDACLQHLACLQDINKDD
YKIILNTAVAEFFKSNQTTTDNLRQTLNQLKNQVHSAVEEMDGLDDVENSMLYYNQAVIL
YHLRQYTEAISVGEKLYQFIEPFEEKFAQAVCFLLVDLYILTYQAEKALHLLAVLEKMIS
QGNNNKNGKNETGNNNNKDGSNHKAESGALIEAAKSKIHQYKVRAYIQMKSLKACKREIK
SVMNTAGNSAPSLFLKSNFEYLRGNYRKAVKLLNSSNIAEHPGFMKTGECLRCMFWNNLG
CIHFAMSKHNLGIFYFKKALQENDNVCAQLSAGSTDPGKKFSGRPMCTLLTNKRYELLYN
CGIQLLHIGRPLAAFECLIEAVQVYHANPRLWLRLAECCIAANKGTSEQETKGLPSKKGI
VQSIVGQGYHRKIVLASQSIQNTVYNDGQSSAIPVASMEFAAICLRNALLLLPEEQQDPK
QENGAKNSNQLGGNTESSESSETCSSKSHDGDKFIPAPPSSPLRKQELENLKCSILACSA
YVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYAAEALISLDRISDAITHLNPENVT
DVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYD
KARKCLHQAASMIHPKEVPPEAILLAVYLELQNGNTQLALQIIKRNQLLPAVKTHSEVRK
KPVFQPVHPIQPIQMPAFTTVQRK
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggctgcagacaagcctgcagatcagggagcagagaaacatgaaggcacaggtcagtcc
tctgggatcactgatcaagagaaggagttatccaccaatgctttccaagctttcacatct
ggaaattatgatgcctgtctacaacaccttgcctgtctacaagatataaacaaagatgat
tataaaataattttgaatacagcagtagctgagttttttaaaagtaaccaaacaacaaca
gataatttgagacaaacacttaaccagctgaagaatcaggtccactcagctgttgaagaa
atggatggattagatgatgttgaaaacagcatgttgtactataatcaagcagtcattctt
tatcatctgcggcagtatacagaagccatatcagttggtgaaaaactttatcagttcata
gagccttttgaagaaaaatttgcccaagcagtgtgttttttgcttgtagacctgtatata
ttaacctaccaagctgagaaagctttgcatcttcttgctgtcctagaaaaaatgatttca
cagggtaacaataacaaaaatggaaagaatgagactggtaataacaacaacaaagatgga
tctaatcataaagctgaaagtggagctctaatagaagctgcaaaatcaaagatacatcag
tacaaagtacgagcttatatccaaatgaagtctctgaaagcatgtaaaagggaaatcaag
tcagtcatgaatacagctggaaattccgcaccctctctctttcttaaaagcaattttgag
tacttaagaggtaattatcgaaaagccgtgaagctattaaatagttcaaacattgctgag
catccaggattcatgaaaacaggtgaatgcttgagatgcatgttctggaataaccttggt
tgcatccattttgccatgagcaagcacaatttgggaatattctactttaaaaaggctctg
caagagaatgacaatgtctgtgcacagctcagtgcaggtagcactgatccaggtaaaaaa
ttttcaggaagacccatgtgtacgttactaaccaataagagatatgagttgctgtataac
tgtggaattcagcttcttcacattggaaggcctcttgctgccttcgaatgtctgattgaa
gctgttcaggtttatcatgcaaatcctcgcctctggctacggctggctgaatgctgcatt
gctgccaataaggggacttctgaacaagaaactaaaggccttcccagcaaaaaaggaatt
gtacagtctattgttggtcaaggctatcatcgtaaaatagttttggcatcacagtctata
cagaatactgtttataatgatgggcagtcttcggccattcctgtagccagtatggagttt
gcagccatatgtctcagaaatgccttgttgctgctacctgaagaacagcaagatccaaag
caggaaaatggggctaaaaatagtaatcaattaggtgggaacacagagagcagcgaaagc
agtgaaacttgcagcagtaaaagccatgatggagataaattcattccagctccaccttct
tctccattgagaaaacaggaattagaaaacttaaagtgctccatacttgcttgcagtgcc
tacgtggctctggctttgggtgataacctcatggctttgaatcatgcagataaacttctt
cagcagcccaagctgtcaggatctcttaagtttttgggacatttatatgctgcagaagcc
ctcatctctctcgacagaatatctgatgccattactcacttgaacccggagaatgtcact
gatgtctccttagggatctcttcaaatgagcaggaccaaggatcagacaaaggtgaaaat
gaagcaatggaatcctctggtaagcgggcccctcagtgctaccccagttccgtcaactct
gccaggactgtgatgctgttcaaccttggcagcgcttactgcctgaggagcgaatatgac
aaagcccgaaagtgtctccaccaggcggcttcaatgatccatcctaaagaggtgccccct
gaggccatcttgctggcagtctaccttgaactgcagaatggtaatactcagctggcctta
cagatcatcaaaaggaatcagctgctccctgcagtgaaaacacactctgaagtgagaaag
aagccagtgtttcagcctgtccacccgatccagcccatccaaatgccggctttcaccact
gtgcagagaaagtga

DBGET integrated database retrieval system