KEGG   Homo sapiens (human): 25909Help
Entry
25909             CDS       T01001                                 

Gene name
AHCTF1, ELYS, MST108, MSTP108, TMBS62
Definition
(RefSeq) AT-hook containing transcription factor 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ELYS-bb ELYS
Motif
Other DBs
NCBI-GeneID: 25909
NCBI-ProteinID: NP_001310271
OMIM: 610853
HGNC: 24618
Ensembl: ENSG00000153207
Vega: OTTHUMG00000040706
Pharos: Q8WYP5(Tbio)
UniProt: Q8WYP5
Position
1q44
AA seq 2266 aa AA seqDB search
MRDLRAQVTSGLLPFPEVTLQALGEDEITLESVLRGKFAAGKNGLACLACGPQLEVVNSI
TGERLSAYRFSGVNEQPPVVLAVKEFSWQKRTGLLIGLEETEGSVLCLYDLGISKVVKAV
VLPGRVTAIEPIINHGGASASTQHLHPSLRWLFGVAAVVTDVGQILLVDLCLDDLSCNQN
EVEASDLEVLTGIPAEVPHIRESVMRQGRHLCFQLVSPTGTAVSTLSYISRTNQLAVGFS
DGYLALWNMKSMKREYYIQLESGQVPVYAVTFQEPENDPRNCCYLWAVQSTQDSEGDVLS
LHLLQLAFGNRKCLASGQILYEGLEYCEERYTLDLTGGMFPLRGQTSNTKLLGCQSIEKF
RSHGDREEGVNEALSPDTSVSVFTWQVNIYGQGKPSVYLGLFDINRWYHAQMPDSLRSGE
YLHNCSYFALWSLESVVSRTSPHGILDILVHERSLNRGVPPSYPPPEQFFNPSTYNFDAT
CLLNSGVVHLTCTGFQKETLTFLKKSGPSLNELIPDGYNRCLVAGLLSPRFVDVQPSSLS
QEEQLEAILSAAIQTSSLGLLTGYIRRWITEEQPNSATNLRFVLEWTWNKVVLTKEEFDR
LCVPLFDGSCHFMDPQTIQSIQQCYLLLSNLNIVLSCFASEAREITERGLIDLSNKFVVS
HLICQYAQVVLWFSHSGLLPEGIDDSVQLSRLCYNYPVIQNYYTSRRQKFERLSRGKWNP
DCLMIDGLVSQLGERIEKLWKRDEGGTGKYPPASLHAVLDMYLLDGVTEAAKHSITIYLL
LDIMYSFPNKTDTPIESFPTVFAISWGQVKLIQGFWLIDHNDYESGLDLLFHPATAKPLS
WQHSKIIQAFMSQGEHRQALRYIQTMKPTVSSGNDVILHLTVLLFNRCMVEAWNFLRQHC
NRLNIEELLKHMYEVCQEMGLMEDLLKLPFTDTEQECLVKFLQSSASVQNHEFLLVHHLQ
RANYVPALKLNQTLKINVMNDRDPRLRERSLARNSILDQYGKILPRVHRKLAIERAKPYH
LSTSSVFRLVSRPKPLSAVPKQVVTGTVLTRSVFINNVLSKIGEVWASKEPINSTTPFNS
SKIEEPSPIVYSLPAPELPEAFFGTPISKASQKISRLLDLVVQPVPRPSQCSEFIQQSSM
KSPLYLVSRSLPSSSQLKGSPQAISRASELHLLETPLVVKKAKSLAMSVTTSGFSEFTPQ
SILRSTLRSTPLASPSPSPGRSPQRLKETRISFVEEDVHPKWIPGAADDSKLEVFTTPKK
CAVPVETEWLKSKDRTTSFFLNSPEKEHQEMDEGSQSLEKLDVSKGNSSVSITSDETTLE
YQDAPSPEDLEETVFTASKPKSSSTALTTNVTEQTEKDGDKDVFASEVTPSDLQKQMGNL
EDAETKDLLVAAEAFSELNHLSPVQGTEASLCAPSVYEGKIFTQKSKVPVLDEGLTSVET
YTPAIRANDNKSMADVLGDGGNSSLTISEGPIVSERRLNQEVALNLKEDHEVEVGVLKES
VDLPEEKLPISDSPPDTQEIHVIEQEKLEAQDSGEEARNLSFNELYPSGTLKLQYNFDTI
DQQFCDLADNKDTAECDIAEVDGELFVAQSNFTLILEGEEGEVEPGDFASSDVLPKAANT
ATEEKLVCSGENDNHGQIANLPSAVTSDQKSQKVDTLPYVPEPIKVAIAENLLDVIKDTR
SKEITSDTMEQSIHETIPLVSQNIMCPTKLVKSAFKTAQETSTMTMNVSQVDDVVSSKTR
TRGQRIQNVNVKSAQQEASADVATPKMPGQSVRKKTRKAKEISEASENIYSDVRGLSQNQ
QIPQNSVTPRRGRRKKEVNQDILENTSSVEQELQITTGRESKRLKSSQLLEPAVEETTKK
EVKVSSVTKRTPRRIKRSVENQESVEIINDLKVSTVTSPSRMIRKLRSTNLDASENTGNK
QDDKSSDKQLRIKHVRRVRGREVSPSDVREDSNLESSQLTVQAEFDMSAIPRKRGRPRKI
NPSEDVGSKAVKEERSPKKKEAPSIRRRSTRNTPAKSENVDVGKPALGKSILVPNEELSM
VMSSKKKLTKKTESQSQKRSLHSVSEERTDEMTHKETNEQEERLLATASFTKSSRSSRTR
SSKAILLPDLSEPNNEPLFSPASEVPRKAKAKKIEVPAQLKELVSDLSSQFVISPPALRS
RQKNTSNKNKLEDELKDDAQSVETLGKPKAKRIRTSKTKQASKNTEKESAWSPPPIEIRL
ISPLASPADGVKSKPRKTTEVTGTGLGRNRKKLSSYPKQILRRKML
NT seq 6801 nt NT seq  +upstreamnt  +downstreamnt
atgcgagacttaagagctcaagtgactagtggtctcctgccatttccagaagtgactctt
caagcccttggagaagacgaaataacattagaatctgtgcttcgtggaaagtttgctgca
gggaaaaatggacttgcttgcttggcttgtggtccacaacttgaggtagtaaactctata
acaggagagcgattgtctgcttacagattcagtggagtcaatgaacagcctcctgtagtt
ttagctgtgaaagaattctcttggcagaagagaactggattattaataggattggaagaa
acagaagggagtgttctctgtctttatgaccttggaatatcaaaagtagttaaagcagtt
gttcttcctggaagggtaacagctattgaacctataattaatcatggaggagccagtgca
agcactcagcatttacatccaagtctgcgatggctttttggagtggcagctgtggtcact
gatgttggacagatccttcttgttgacctatgtttggatgacttgtcatgcaatcaaaat
gaagttgaagcatcagatcttgaagttctaactggtatcccagctgaagtaccacacatt
agagaaagtgtaatgagacaagggcgccatctgtgtttccagttagtaagtccaacagga
acagctgtttcaactcttagttacataagcaggacaaatcagcttgctgtaggtttttct
gatggctatctagcactttggaacatgaaaagcatgaaaagagaatattacatacaattg
gaaagtggacaagttcctgtatatgctgtcacttttcaagaacctgagaatgatcctcgg
aattgctgttacttgtgggctgttcagtctacacaagatagtgaaggggatgttttgagt
ttgcatctgctgcagctggcctttggtaatagaaagtgtttggcatcaggacaaatctta
tatgaggggttagaatactgtgaagaaagatacaccctggacctgacaggtggcatgttc
cctttgaggggacagacgagtaataccaaattgttgggatgccagagtatagagaaattt
cgatctcatggtgacagggaggaaggcgtgaatgaagctctatcgcctgacactagtgtt
tcagtctttacctggcaggtgaatatatatggacagggaaagccttctgtatatttgggg
ctttttgatataaatcgttggtatcatgcacaaatgccagattcgttaaggtcaggagaa
tatctacataattgctcttattttgcactgtggtcattggagtctgttgtaagtaggact
tctccacatggcatcttggatatattagtacatgagagaagtttaaatagaggagtccct
ccttcatatccacctcccgagcagttttttaatccaagcacttataattttgatgccact
tgtttgttaaactcgggagttgttcatttaacttgtactggctttcagaaggagactttg
acttttttaaagaaatcaggtccatcactcaatgaactcattcctgatggttataatcga
tgtcttgtagctggccttctttccccaagatttgttgatgttcagccttccagtttaagc
caagaagaacagttagaagctatattgtcagcagcaattcagactagttccctgggactt
ttgactggttatatccgaagatggataacagaagaacaaccaaattctgccactaatttg
cgctttgttcttgaatggacgtggaataaagtggttctcacaaaagaggaatttgacaga
ctatgtgtgccattatttgatggttcgtgtcatttcatggatccacaaactatacagtct
atccagcaatgctatttgcttcttagcaatcttaatatagtcttgagctgttttgcatca
gaagcccgagagatcactgagagaggactgatagacttaagcaataagtttgtggtttcc
cacctcatctgtcagtatgcacaagtggttctttggttctctcattctgggcttttacca
gaaggcatagatgattctgtgcagttgtcaaggttatgctacaactaccctgtaattcag
aactactacaccagtcgtcgacagaagtttgagcgtttatcaagagggaagtggaatccc
gattgcttgatgattgatggactggtttctcagttaggagagcgaattgagaagttgtgg
aaacgagatgaaggaggcacaggaaaatatcctcctgctagtctgcatgcagtacttgat
atgtacctattagacggcgttactgaagcagccaaacactctattaccatttatttgcta
cttgatattatgtattcctttcccaacaaaacagacactcccattgaatctttcccaact
gtatttgccatttcttggggccaagttaaacttattcaggggttttggttgatagatcat
aatgactatgagagtggtttggatcttttgtttcatccagctactgcaaaacctttgtca
tggcaacattcaaagattattcaggcattcatgagtcagggcgagcacagacaagccctc
agatatattcagacaatgaagccaacagtgtccagtggtaacgatgttatccttcacctc
actgttttgctttttaataggtgtatggttgaagcctggaattttttgcggcaacattgc
aataggttgaatatagaggagttactgaagcacatgtatgaagtctgtcaggaaatgggc
ttgatggaagatttactgaagttaccatttacagacactgagcaggaatgtttagtgaaa
tttttgcagtccagtgccagcgttcagaatcatgaattccttttagtgcaccatttgcag
cgtgccaattatgtgcctgccttgaagctgaaccaaactctgaagattaatgttatgaat
gatcgtgatcctcgtttgcgggagagatcactggctcgaaattctatattagaccagtat
ggaaaaatccttcctagagtccatcgaaaattagccattgaacgagctaagccttatcat
ctgtcaacatcatcagtttttcgattagtttctagacccaaaccattatcagcagttcca
aagcaagttgtaacaggaactgtgttgacaagatctgttttcatcaacaatgtgttatct
aaaattggagaagtttgggcaagcaaagaacctataaatagcaccacacctttcaatagt
tctaaaatagaagaaccatctcctatagtgtattcgctcccagctccagagctgcctgag
gcattttttggaacaccaatttcaaaagcatcacaaaaaatttctagactgctagatttg
gttgttcagcctgtcccccggccttctcagtgttcggagtttattcagcaaagctccatg
aaatctcctttgtacctagtatcccgttcactgccctcaagttcgcaattaaaaggatcg
cctcaggccatctccagggcttcagaattacatttgcttgaaactcctcttgtagttaag
aaagctaaaagtttggccatgtcagttactacttctggattttctgagttcactcctcag
tccatcctgaggtctactcttcgatcaacacctttagcatctccctctccatcacctgga
aggtctcctcaacgacttaaagaaactagaatttcatttgtggaagaagatgtccaccca
aaatggattcctggggctgcagatgatagcaaattagaagtatttactacacctaaaaaa
tgtgcagttccagtggaaactgaatggctgaagagcaaagataggaccacatcttttttc
ctgaacagccctgaaaaggagcatcaagaaatggatgaggggtcacaaagtttagagaaa
ctggatgtgagcaaaggaaacagcagtgtttcaatcacatccgatgagactaccttagag
tatcaggatgcaccgtcaccggaagaccttgaagagactgttttcacggcctctaagccc
aaaagctcttccactgcactaactactaatgtaactgaacaaactgaaaaggatggagat
aaagatgtatttgcatcagaagtaactccttcagacctacagaaacaaatgggcaattta
gaagatgcagaaacaaaggatctcttagttgcagcagaggcattttcagaattgaatcac
ttaagcccggttcaaggaactgaagcttctctttgtgcaccatcagtctatgaagggaaa
atcttcacccagaagtccaaggtaccagtgttggacgaaggattaacatctgttgaaacc
tacacccctgcaattagagcaaatgacaataaatctatggctgatgtccttggtgatggt
ggaaactcctcgctcactatctctgaaggtcctattgtctctgagcgcaggcttaaccag
gaagtagcgctgaacttaaaagaagatcatgaagtagaagttggtgtactaaaagaaagt
gttgacttaccagaagaaaagcttccaatttctgacagccctcctgatactcaagaaatt
catgtgattgaacaagaaaagcttgaagctcaagattcaggagaagaggctaggaatctt
tcatttaatgagttatatccctctggaacacttaagcttcagtacaattttgatactatt
gaccaacagttttgtgacttagctgataacaaagacactgctgaatgtgacattgctgaa
gtagatggggaactttttgtggctcaaagcaactttaccttgatattggaaggtgaagaa
ggagaagttgagccaggtgattttgcatcatctgatgtgttacctaaagcagctaacaca
gcaactgaagaaaaacttgtatgcagtggggaaaatgataatcatggacaaattgcaaat
ttgccatctgccgtaactagtgaccaaaagtcccaaaaagtagacactttaccatatgtg
cctgaacctattaaagtagcaattgcagaaaatttactagatgtaattaaagacacaaga
agtaaagaaattacttcagatacaatggaacagtccattcatgaaacaatacctttagtg
agccaaaacataatgtgtcccactaaattggtcaaatctgcatttaagactgctcaggaa
acaagcacaatgactatgaatgtcagccaggttgatgacgtggtttcctccaaaactcgt
acgagaggtcaacgtatccaaaacgtgaatgtcaaatcagcacaacaggaagcatcagca
gatgttgctactcctaagatgccagggcagtcagtcaggaagaaaactaggaaggcaaaa
gaaatttctgaagcttctgaaaacatctattctgatgtcagaggactatctcagaaccag
caaatacctcaaaattctgttacgcctaggagaggaaggagaaagaaagaagttaatcag
gacatactagaaaacaccagttctgtggaacaagaattacagatcactacaggtagggaa
tcaaaaagattaaaatcatctcagctgttggaaccagcagttgaagaaactactaaaaaa
gaagttaaggtttcatctgttacaaaaaggactcctagaagaattaaaagatctgtagaa
aatcaggaaagtgttgaaattataaatgatctaaaagttagtacggtaacaagtcctagc
agaatgatcagaaaattgagaagtactaatttagatgcttctgaaaatacaggaaataag
caagatgataaatccagtgacaagcagctgcgtattaaacatgttagaagggtcagaggg
agagaagttagtccatcagatgtgagagaagactccaaccttgagtcatctcagttgact
gttcaagcagaatttgatatgtctgccatacctagaaaacgtggtagaccaagaaaaatc
aatccatctgaagatgtaggatctaaggctgttaaggaagagagaagccccaagaagaaa
gaagctcccagcattagaaggagatctacaagaaataccccagctaaaagtgaaaatgtt
gatgttggaaaaccagctttaggaaaatccattttagtgccaaacgaggaactttcgatg
gtgatgagctctaagaaaaaacttacaaaaaagactgaaagtcaaagccaaaaacgttca
ttgcactcagtatcagaagaacgcacagatgaaatgacacataaagaaacaaatgagcag
gaagaaagattgctcgccacagcttccttcactaaatcatcccgcagcagcaggactcgg
tctagcaaggccatcttgttgccggacctttctgaaccaaacaatgagcctttattttct
ccagcgtcagaagttccaaggaaagcaaaagctaaaaaaatagaggttcctgcacagctg
aaagaattagtttcggatttatcttctcagtttgtcatctcacctcctgctttaaggagc
agacaaaaaaacacatccaataagaacaagcttgaagatgaactgaaagatgatgcacaa
tcagtagaaactctgggaaagccaaaagcgaaacgaatcaggacgtcaaaaacaaaacaa
gcaagcaaaaacacagaaaaagaaagtgcttggtcacctcctcccatagaaattcggctg
atttcccccttggctagcccagctgacggagtcaagagcaaaccaagaaaaactacagaa
gtgacaggaacaggtcttggaaggaacagaaagaaactgtcttcctatccaaagcaaatt
ttacgcagaaaaatgctgtaa

DBGET integrated database retrieval system