KEGG   Homo sapiens (human): 25913Help
Entry
25913             CDS       T01001                                 

Gene name
POT1, CMM10, GLM9, HPOT1
Definition
(RefSeq) protection of telomeres 1
  KO
K11109  protection of telomeres protein 1
Organism
hsa  Homo sapiens (human)
Module
hsa_M00424  Shelterin complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    25913 (POT1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomere proteins
    Shelterin complex
     25913 (POT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: POT1PC POT1
Motif
Other DBs
NCBI-GeneID: 25913
NCBI-ProteinID: NP_056265
OMIM: 606478
HGNC: 17284
Ensembl: ENSG00000128513
Vega: OTTHUMG00000157194
Pharos: Q9NUX5(Tbio)
UniProt: Q9NUX5 A0A024R739
Structure
PDB: 

Position
7q31.33
AA seq 634 aa AA seqDB search
MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCL
LFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLTFEGTLGAPIIPRTSS
KYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFL
LKVWDGTRTPFPSWRVLIQDLVLEGDLSHIHRLQNLTIDILVYDNHVHVARSLKVGSFLR
IYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTAN
QHSDVICQSEPDDSFPSSGSVSLYEVERCQQLSATILTDHQYLERTPLCAILKQKAPQQY
RIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKTPDVKLQNTSLYD
SKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSNKFNSVIPVRSGH
EDLELLDLSAPFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQY
VFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAY
PWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtctttggttccagcaacaaattatatatatacacccctgaatcaacttaagggtggt
acaattgtcaatgtctatggtgttgtgaagttctttaagcccccatatctaagcaaagga
actgattattgctcagttgtaactattgtggaccagacaaatgtaaaactaacttgcctg
ctctttagtggaaactatgaagcccttccaataatttataaaaatggagatattgttcgc
tttcacaggctgaagattcaagtatataaaaaggagactcagggtatcaccagctctggc
tttgcatctttgacgtttgagggaactttgggagcccctatcatacctcgcacttcaagc
aagtattttaacttcactactgaggaccacaaaatggtagaagccttacgtgtttgggca
tctactcatatgtcaccgtcttggacattactaaaattgtgtgatgttcagccaatgcag
tattttgacctgacttgtcagctcttgggcaaagcagaagtggacggagcatcatttctt
ctaaaggtatgggatggcaccaggacaccatttccatcttggagagtcttaatacaagac
cttgttcttgaaggtgatttaagtcacatccatcggctacaaaatctgacaatagacatt
ttagtctacgataaccatgttcatgtggcaagatctctgaaggttggaagctttcttaga
atctatagccttcataccaaacttcaatcaatgaattcagagaatcagacaatgttaagt
ttagagtttcatcttcatggaggtaccagttacggtcggggaatcagggtcttgccagaa
agtaactctgatgtggatcaactgaaaaaggatttagaatctgcaaatttgacagccaat
cagcattcagatgttatctgtcaatcagaacctgacgacagctttccaagctctggatca
gtatcattatacgaggtagaaagatgtcaacagctatctgctacaatacttacagatcat
cagtatttggagaggacaccactatgtgccattttgaaacaaaaagctcctcaacaatac
cgcatccgagcaaaattgaggtcatataagcccagaagactatttcagtctgttaaactt
cattgccctaaatgtcatttgctgcaagaagttccacatgagggcgatttggatataatt
tttcaggatggtgcaactaaaaccccagatgtcaagctacaaaatacatcattatatgat
tcaaaaatctggaccactaaaaatcaaaaaggacgaaaagtagcagttcattttgtgaaa
aataatggtattctcccgctttcaaatgaatgtctacttttgatagaaggaggtacactc
agtgaaatttgcaaactctcgaacaagtttaatagtgtaattcctgtgagatctggccac
gaagacctggaacttttggacctttcagcaccatttcttatacaaggaacaatacatcac
tatggatgtaaacagtgttctagtttgagatccatacaaaatctaaattccctggttgat
aaaacatcgtggattccttcttctgtggcagaagcactgggtattgtacccctccaatat
gtgtttgttatgacctttacacttgatgatggaacaggagtactagaagcctatctcatg
gattctgacaaattcttccagattccagcatcagaagttctgatggatgatgaccttcag
aaaagtgtggatatgatcatggatatgttttgtcctccaggaataaaaattgatgcatat
ccgtggttggaatgcttcatcaagtcatacaatgtcacaaatggaacagataatcaaatt
tgctatcagatttttgacaccacagttgcagaagatgtaatctaa

DBGET integrated database retrieval system