KEGG   Homo sapiens (human): 25915
Entry
25915             CDS       T01001                                 

Gene name
NDUFAF3, 2P1, C3orf60, E3-3, MC1DN18
Definition
(RefSeq) NADH:ubiquinone oxidoreductase complex assembly factor 3
  KO
K09008  NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    25915 (NDUFAF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    25915 (NDUFAF3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    25915 (NDUFAF3)
SSDB
Motif
Pfam: DUF498 NAD_binding_7
Other DBs
NCBI-GeneID: 25915
NCBI-ProteinID: NP_951032
OMIM: 612911
HGNC: 29918
Ensembl: ENSG00000178057
Vega: OTTHUMG00000156773
Pharos: Q9BU61(Tclin)
UniProt: Q9BU61 Q9Y3Z0
Position
3p21.31
AA seq 184 aa
MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYI
DSYNSRGFMINGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTG
DRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLG
QAAQ
NT seq 555 nt   +upstreamnt  +downstreamnt
atggccaccgctctcgcgctacgtagcttgtaccgagcgcgaccctcgctgcgctgtccg
cccgttgagcttccctgggccccgcggcgagggcatcggctctcgccggcggatgacgag
ctgtatcagcggacgcgcatctctctgctgcaacgcgaggccgctcaggcaatgtacatc
gacagctacaacagccgcggcttcatgataaacggaaaccgcgtgctcggcccctgcgct
ctgctcccgcactcggtggtgcagtggaacgtgggatcccaccaggacatcaccgaagac
agcttttccctcttctggttgctggagccccggatagagatcgtggtggtggggactgga
gaccggaccgagaggctgcagtcccaggtgcttcaagccatgaggcagcggggcattgct
gtggaagtgcaggacacgcccaatgcctgtgccaccttcaacttcctgtgtcatgaaggc
cgagtaactggagctgctctcatccctccaccaggagggacttcacttacatctttgggc
caagctgctcaatga

DBGET integrated database retrieval system