KEGG   Homo sapiens (human): 25920
Entry
25920             CDS       T01001                                 

Gene name
NELFB, COBRA1, NELF-B
Definition
(RefSeq) negative elongation factor complex member B
  KO
K15180  negative elongation factor B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    25920 (NELFB)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    NELF complex
     25920 (NELFB)
SSDB
Motif
Pfam: COBRA1
Other DBs
NCBI-GeneID: 25920
NCBI-ProteinID: NP_056271
OMIM: 611180
HGNC: 24324
Ensembl: ENSG00000188986
Vega: OTTHUMG00000131778
Pharos: Q8WX92(Tbio)
UniProt: Q8WX92
Structure
PDB: 
6GML

Position
9q34.3
AA seq 628 aa
MAELEGAGERGSGGPRGPAERASGVSAAAPGERAGDGAPSRAVAGASAMFAGLQDLGVAN
GEDLKETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDK
LLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHLPKVPEKKLKLVM
ADKELYRACAVEVKRQIWQDNQALFGDEVSPLLKQYILEKESALFSTELSVLHNFFSPSP
KTRRQGEVVQRLTRMVGKNVKLYDMVLQFLRTLFLRTRNVHYCTLRAELLMSLHDLDVGE
ICTVDPCHKFTWCLDACIRERFVDSKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAIN
TLALSTVRHLQELVGQETLPRDSPDLLLLLRLLALGQGAWDMIDSQVFKEPKMEVELITR
FLPMLMSFLVDDYTFNVDQKLPAEEKAPVSYPNTLPESFTKFLQEQRMACEVGLYYVLHI
TKQRNKNALLRLLPGLVETFGDLAFGDIFLHLLTGNLALLADEFALEDFCSSLFDGFFLT
ASPRKENVHRHALRLLIHLHPRVAPSKLEALQKALEPTGQSGEAVKELYSQLGEKLEQLD
HRKPSPAQAAETPALELPLPSVPAPAPL
NT seq 1887 nt   +upstreamnt  +downstreamnt
ctggccgagctggagggcgccggggagcggggctcgggcggtccccgaggcccggcggag
cgggcttctggggtgtctgcggcggcgccgggggaacgggctggggatggggcgcctagc
cgggcggtggccggggcctcggccatgttcgcggggctgcaggacctgggcgtggccaac
ggcgaggacctgaaggagaccctgaccaactgcacggagccgctcaaggccatcgagcag
ttccagacagagaatggtgtgctgctgccatctcttcagtcagccctccccttcttggac
ctgcacgggacgccgcggctggagttccaccagtcggtattcgatgagctgcgggacaag
ctgctggagcgagtgtcagccatcgcttcggaggggaaggctgaggaaaggtacaagaag
ctggaagaccttctggagaagagcttttctctggtgaagatgccgtccctgcagcccgtg
gtgatgtgcgtcatgaagcacctgcccaaggttccggagaaaaaactgaagctggttatg
gctgacaaggagctgtatcgagcctgcgccgtggaggtgaagcggcagatctggcaagac
aaccaggccctcttcggggacgaggtttccccactcctgaagcagtacatcctggagaag
gagagcgctctcttcagtacagagctctctgtcctgcacaactttttcagtccttccccc
aagaccaggcgccagggcgaggtggtgcagcggctgacgcggatggtggggaagaacgtg
aagctgtacgacatggtgctgcagtttctgcgcacgctcttcctgcgcacgcggaatgtg
cactactgcacgctgcgggctgagctgctcatgtccctgcacgacctggacgtgggtgaa
atctgcaccgtggacccgtgccacaagttcacctggtgcctggacgcctgcatccgagag
cggttcgtggacagcaagagggcgcgggagctgcaggggtttctcgatggcgtcaagaag
ggccaggagcaggtgctgggggacctgtccatgatcctgtgtgaccccttcgccatcaac
acgctggcactgagcacagtcaggcacctgcaggagctggtcggccaggagacactgccc
agggacagccccgacctcctgctgctgctccggctgctggcgctgggccagggagcctgg
gacatgatcgacagccaggtcttcaaggagcccaagatggaggtagagctcatcaccagg
ttcctcccgatgctcatgtccttcctggtggatgactacactttcaatgtggatcagaaa
cttccggctgaggagaaagccccagtctcatatccaaacacacttcccgaaagcttcact
aagtttctgcaggagcagcgcatggcctgcgaggtggggctgtactacgtcctgcacatc
accaagcagaggaacaagaacgcgctcctccgcctgctgcccgggctggtggagaccttt
ggcgacttggcctttggcgacatcttcctccacctgctcacgggcaaccttgcgctgctg
gccgacgaatttgcccttgaggacttctgcagcagcctcttcgatggcttcttcctcacc
gcctctccaaggaaggagaacgtgcaccggcacgcgctgcggctcctcattcacctgcac
cccagggtggccccgtctaagctggaggcgttgcagaaggccctggagcctacaggccag
agcggagaggcagtgaaggagctttactcccagctcggcgagaagctggaacagctggat
caccggaagcccagcccggcacaggctgcggagacgccggccctggagctgcccctcccc
agcgtgcccgcccctgccccgctctga

DBGET integrated database retrieval system