KEGG   Homo sapiens (human): 259230
Entry
259230            CDS       T01001                                 
Symbol
SGMS1, MOB, MOB1, SMS1, TMEM23, hmob33
Name
(RefSeq) sphingomyelin synthase 1
  KO
K04714  shingomyelin synthase [EC:2.7.8.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    259230 (SGMS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    259230 (SGMS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.27  sphingomyelin synthase
     259230 (SGMS1)
SSDB
Motif
Pfam: PAP2_C SAM_3 PAP2 SAM_1 UPF0220 SAM_PNT SAM_2 PAP2_3
Other DBs
NCBI-GeneID: 259230
NCBI-ProteinID: NP_671512
OMIM: 611573
HGNC: 29799
Ensembl: ENSG00000198964
Pharos: Q86VZ5(Tbio)
UniProt: Q86VZ5
Position
10:complement(50305600..50625184)
AA seq 413 aa
MKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRL
LDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPM
PELERSQYPMEWGKTFLAFLYALSCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRV
QWAFSICEINGMILVGLWLIQWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTTLPVPGM
HFNCSPKLFGDWEAQLRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVMLTLTYLFIKEYS
PRRLWWYHWICWLLSVVGIFCILLAHDHYTVDVVVAYYITTRLFWWYHTMANQQVLKEAS
QMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFPWPVVHLSRQVKYSRLVNDT
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaaggaagtggtttattggtcacccaagaaggtggcagactggctgctggagaatgct
atgccagaatactgtgagcctctggagcatttcacaggccaggacttgatcaacctaacc
caagaggatttcaaaaaaccccccttgtgccgagtctcctctgacaatgggcagcggctc
ctggacatgatagaaaccctgaaaatggagcaccatttggaagcacacaagaacggccat
gccaatgggcacctcaacattggcgtagacatccccacccccgacggcagcttcagcatc
aagattaaacccaacgggatgccaaatgggtataggaaagagatgataaagatccccatg
ccagaactggagcgctctcagtaccccatggagtggggcaagacttttctggcctttctt
tatgcactttcctgtttcgttctcaccacagtgatgatctcggtcgtccacgaacgagta
cctcctaaggaggtgcagcctccactaccggacacattttttgaccattttaaccgggtg
cagtgggccttttctatttgtgaaattaatggcatgatccttgtaggactctggttaatt
cagtggctgctcttaaaatacaagtctattattagcagaagatttttctgcatagttggc
acgctgtacctgtatcggtgtattacaatgtatgtaactacactcccagtacctggtatg
catttcaactgttctccgaagcttttcggagactgggaagcccaactgcgaagaataatg
aagctcattgctggaggtggcttgtctatcactggctctcacaacatgtgtggggactat
ctgtacagcggccacacggtcatgctaacacttacctacttatttatcaaagagtattcc
cctcggcgactctggtggtatcactggatttgctggcttctcagcgtagttggaatcttc
tgtattctcttagcgcatgaccactacactgtggacgtggtggtggcatattacatcacc
acgagactcttctggtggtatcacactatggccaatcagcaagtgctaaaggaagcttcc
cagatgaacctcctggccagggtgtggtggtacaggccatttcagtactttgaaaagaat
gtccaaggaattgtacctcgatcttaccattggcctttcccctggccagtagtccacctc
agtaggcaagttaaatacagccggctggtgaatgacacataa

DBGET integrated database retrieval system