KEGG   Homo sapiens (human): 259236Help
Entry
259236            CDS       T01001                                 

Gene name
TMIE, DFNB6
Definition
(RefSeq) transmembrane inner ear
Organism
hsa  Homo sapiens (human)
Disease
H00605  Deafness, autosomal recessive
SSDB OrthologParalogGFIT
Motif
Pfam: TMIE GAPT
Motif
Other DBs
NCBI-GeneID: 259236
NCBI-ProteinID: NP_671729
OMIM: 607237
HGNC: 30800
Ensembl: ENSG00000181585
Vega: OTTHUMG00000149909
Pharos: Q8NEW7(Tbio)
UniProt: Q8NEW7
Position
3p21.31
AA seq 156 aa AA seqDB search
MAGWPGAGPLCVLGGAALGVCLAGVAGQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVV
GIFSLFVLSIIITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPG
EDKKKKKKKKKDSVDTVAIKVEEDEKNEAKKKKGEK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtggccgggcgcgggtcccctctgcgtgctgggcggcgccgcactcggggtg
tgcctcgcgggggttgccgggcagctggtggagcccagcacggccccacccaagcccaag
ccgcctccgctgaccaaggagacagtggtgttctgggacatgcgcctgtggcacgtggtg
ggcatcttttcgctcttcgtgttgtccatcatcatcacgctgtgctgtgtcttcaactgt
cgtgtgccacggacccggaaggagatcgaagcccggtacctgcagcgaaaggcagccaag
atgtacacagacaagctggagactgtgccacccctcaatgagctcacagaagtcccagga
gaggataagaagaagaagaagaagaagaagaaggacagtgtggacacagtggccatcaaa
gtagaggaggatgagaagaatgaggccaagaagaagaaaggagagaaatga

DBGET integrated database retrieval system