KEGG   Homo sapiens (human): 259236Help
Entry
259236            CDS       T01001                                 

Gene name
TMIE, DFNB6
Definition
(RefSeq) transmembrane inner ear
  KO
K23907  transmembrane inner ear expressed protein
Organism
hsa  Homo sapiens (human)
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    259236 (TMIE)
Transporters [BR:hsa02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   259236 (TMIE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TMIE GAPT
Motif
Other DBs
NCBI-GeneID: 259236
NCBI-ProteinID: NP_671729
OMIM: 607237
HGNC: 30800
Ensembl: ENSG00000181585
Vega: OTTHUMG00000149909
Pharos: Q8NEW7(Tbio)
UniProt: Q8NEW7
Position
3p21.31
AA seq 156 aa AA seqDB search
MAGWPGAGPLCVLGGAALGVCLAGVAGQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVV
GIFSLFVLSIIITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPG
EDKKKKKKKKKDSVDTVAIKVEEDEKNEAKKKKGEK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtggccgggcgcgggtcccctctgcgtgctgggcggcgccgcactcggggtg
tgcctcgcgggggttgccgggcagctggtggagcccagcacggccccacccaagcccaag
ccgcctccgctgaccaaggagacagtggtgttctgggacatgcgcctgtggcacgtggtg
ggcatcttttcgctcttcgtgttgtccatcatcatcacgctgtgctgtgtcttcaactgt
cgtgtgccacggacccggaaggagatcgaagcccggtacctgcagcgaaaggcagccaag
atgtacacagacaagctggagactgtgccacccctcaatgagctcacagaagtcccagga
gaggataagaagaagaagaagaagaagaagaaggacagtgtggacacagtggccatcaaa
gtagaggaggatgagaagaatgaggccaagaagaagaaaggagagaaatga

DBGET integrated database retrieval system