KEGG   Homo sapiens (human): 259249
Entry
259249            CDS       T01001                                 

Gene name
MRGPRX1, GPCR, MGRG2, MRGX1, SNSR4
Definition
(RefSeq) MAS related GPR family member X1
  KO
K08396  Mas-related G protein-coupled receptor member X
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259249 (MRGPRX1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Mas proto-oncogene and Mas-related (MRGs)
    259249 (MRGPRX1)
SSDB
Motif
Pfam: 7tm_1 TcpE
Other DBs
NCBI-GeneID: 259249
NCBI-ProteinID: NP_671732
OMIM: 607227
HGNC: 17962
Ensembl: ENSG00000170255
Vega: OTTHUMG00000162655
Pharos: Q96LB2(Tchem)
UniProt: Q96LB2 W8W3P5
Position
11p15.1; 11
AA seq 322 aa
MDPTISTLDTELTPINGTEETLCYKQTLSLTVLTCIVSLVGLTGNAVVLWLLGCRMRRNA
FSIYILNLAAADFLFLSGRLIYSLLSFISIPHTISKILYPVMMFSYFAGLSFLSAVSTER
CLSVLWPIWYRCHRPTHLSAVVCVLLWALSLLRSILEWMLCGFLFSGADSAWCQTSDFIT
VAWLIFLCVVLCGSSLVLLIRILCGSRKIPLTRLYVTILLTVLVFLLCGLPFGIQFFLFL
WIHVDREVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASE
VDEGGGQLPEEILELSGSRLEQ
NT seq 969 nt   +upstreamnt  +downstreamnt
atggatccaaccatctcaaccttggacacagaactgacaccaatcaacggaactgaggag
actctttgctacaagcagaccttgagcctcacggtgctgacgtgcatcgtttcccttgtc
gggctgacaggaaacgcagttgtgctctggctcctgggctgccgcatgcgcaggaacgcc
ttctccatctacatcctcaacttggccgcagcagacttcctcttcctcagcggccgcctt
atatattccctgttaagcttcatcagtatcccccataccatctctaaaatcctctatcct
gtgatgatgttttcctactttgcaggcctgagctttctgagtgccgtgagcaccgagcgc
tgcctgtccgtcctgtggcccatctggtaccgctgccaccgccccacacacctgtcagcg
gtggtgtgtgtcctgctctgggccctgtccctgctgcggagcatcctggagtggatgtta
tgtggcttcctgttcagtggtgctgattctgcttggtgtcaaacatcagatttcatcaca
gtcgcgtggctgatttttttatgtgtggttctctgtgggtccagcctggtcctgctgatc
aggattctctgtggatcccggaagataccgctgaccaggctgtacgtgaccatcctgctc
acagtactggtcttcctcctctgtggcctgccctttggcattcagtttttcctattttta
tggatccacgtggacagggaagtcttattttgtcatgttcatctagtttctattttcctg
tccgctcttaacagcagtgccaaccccatcatttacttcttcgtgggctcctttaggcag
cgtcaaaataggcagaacctgaagctggttctccagagggctctgcaggacgcgtctgag
gtggatgaaggtggagggcagcttcctgaggaaatcctggagctgtcgggaagcagattg
gagcagtga

DBGET integrated database retrieval system