KEGG   Homo sapiens (human): 259266Help
Entry
259266            CDS       T01001                                 

Gene name
ASPM, ASP, Calmbp1, MCPH5
Definition
(RefSeq) assembly factor for spindle microtubules
  KO
K16743  abnormal spindle-like microcephaly-associated protein
Organism
hsa  Homo sapiens (human)
Disease
H00269  Primary microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    259266 (ASPM)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    259266 (ASPM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IQ ASH CH CAMSAP_CH
Motif
Other DBs
NCBI-GeneID: 259266
NCBI-ProteinID: NP_060606
OMIM: 605481
HGNC: 19048
Ensembl: ENSG00000066279
Vega: OTTHUMG00000036277
Pharos: Q8IZT6(Tbio)
UniProt: Q8IZT6 B3KWI2
Position
1q31.3
AA seq 3477 aa AA seqDB search
MANRRVGRGCWEVSPTERRPPAGLRGPAAEEEASSPPVLSLSHFCRSPFLCFGDVLLGAS
RTLSLALDNPNEEVAEVKISHFPAADLGFSVSQRCFVLQPKEKIVISVNWTPLKEGRVRE
IMTFLVNDVLKHQAILLGNAEEQKKKKRSLWDTIKKKKISASTSHNRRVSNIQNVNKTFS
VSQKVDRVRSPLQACENLAMNEGGPPTENNSLILEENKIPISPISPAFNECHGATCLPLS
VRRSTTYSSLHASENRELLNVHSANVSKVSFNEKAVTETSFNSVNVNGQRGENSKLSLTP
NCSSTLNITQSQIHFLSPDSFVNNSHGANNELELVTCLSSDMFMKDNSQPVHLESTIAHE
IYQKILSPDSFIKDNYGLNQDLESESVNPILSPNQFLKDNMAYMCTSQQTCKVPLSNENS
QVPQSPEDWRKSEVSPRIPECQGSKSPKAIFEELVEMKSNYYSFIKQNNPKFSAVQDISS
HSHNKQPKRRPILSATVTKRKATCTRENQTEINKPKAKRCLNSAVGEHEKVINNQKEKED
FHSYLPIIDPILSKSKSYKNEVTPSSTTASVARKRKSDGSMEDANVRVAITEHTEVREIK
RIHFSPSEPKTSAVKKTKNVTTPISKRISNREKLNLKKKTDLSIFRTPISKTNKRTKPII
AVAQSSLTFIKPLKTDIPRHPMPFAAKNMFYDERWKEKQEQGFTWWLNFILTPDDFTVKT
NISEVNAATLLLGIENQHKISVPRAPTKEEMSLRAYTARCRLNRLRRAACRLFTSEKMVK
AIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGELISLED
NSDVTGLAMFILNRLLWNPDIAAEYRHPTVPHLYRDGHEEALSKFTLKKLLLLVCFLDYA
KISRLIDHDPCLFCKDAEFKASKEILLAFSRDFLSGEGDLSRHLGLLGLPVNHVQTPFDE
FDFAVTNLAVDLQCGVRLVRTMELLTQNWDLSKKLRIPAISRLQKMHNVDIVLQVLKSRG
IELSDEHGNTILSKDIVDRHREKTLRLLWKIAFAFQVDISLNLDQLKEEIAFLKHTKSIK
KTISLLSCHSDDLINKKKGKRDSGSFEQYSENIKLLMDWVNAVCAFYNKKVENFTVSFSD
GRVLCYLIHHYHPCYVPFDAICQRTTQTVECTQTGSVVLNSSSESDDSSLDMSLKAFDHE
NTSELYKELLENEKKNFHLVRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCARL
LDLRKEIRAARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAAL
VIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQGYWRRYSTRQRFLKLKYYSIILQSR
IRMIIAVTSYKRYLWATVTIQRHWRAYLRRKQDQQRYEMLKSSTLIIQSMFRKWKQRKMQ
SQVKATVILQRAFREWHLRKQAKEENSAIIIQSWYRMHKELRKYIYIRSCVVIIQKRFRC
FQAQKLYKRRKESILTIQKYYKAYLKGKIERTNYLQKRAAAIQLQAAFRRLKAHNLCRQI
RAACVIQSYWRMRQDRVRFLNLKKTIIKFQAHVRKHQQRQKYKKMKKAAVIIQTHFRAYI
FAMKVLASYQKTRSAVIVLQSAYRGMQARKMYIHILTSVIKIQSYYRAYVSKKEFLSLKN
ATIKLQSTVKMKQTRKQYLHLRAAALFIQQCYRSKKIAAQKREEYMQMRESCIKLQAFVR
GYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKNFLQ
VKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRA
YKTLHDTRTHFLKTKAAVISLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLF
KTAALVIQQNFRAWTAGRKQCMEYIELRHAVLVLQSMWKGKTLRRQLQRQHKCAIIIQSY
YRMHVQQKKWKIMKKAALLIQKYYRAYSIGREQNHLYLKTKAAVVTLQSAYRGMKVRKRI
KDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITNHQHKEYLNLKKTAIKI
QSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRCRAYYQGKMQR
EKYLTILKAVKVLQASFRGVRVRRTLRKMQTAATLIQSNYRRYRQQTYFNKLKKITKTVQ
QRYWAMKERNIQFQRYNKLRHSVIYIQAIFRGKKARRHLKMMHIAATLIQRRFRTLMMRR
RFLSLKKTAILIQRKYRAHLCTKHHLQFLQVQNAVIKIQSSYRRWMIRKRMREMHRAATF
IQSTFRMHRLHMRYQALKQASVVIQQQYQANRAAKLQRQHYLRQRHSAVILQAAFRGMKT
RRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHKLYQFLHLRKA
AITIQSSYRRLMVKKKLQEMQRAAVLIQATFRMYRTYITFQTWKHASILIQQHYRTYRAA
KLQRENYIRQWHSAVVIQAAYKGMKARQLLREKHKASIVIQSTYRMYRQYCFYQKLQWAT
KIIQEKYRANKKKQKVFQHNELKKETCVQAGFQDMNIKKQIQEQHQAAIIIQKHCKAFKI
RKHYLHLRATVVSIQRRYRKLTAVRTQAVICIQSYYRGFKVRKDIQNMHRAATLIQSFYR
MHRAKVDYETKKTAIVVIQNYYRLYVRVKTERKNFLAVQKSVRTIQAAFRGMKVRQKLKN
VSEEKMAAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASGLACSQEAEYHSQSRAAVT
IQKAFCRMVTRKLETQKCAALRIQFFLQMAVYRRRFVQQKRAAITLQHYFRTWQTRKQFL
LYRKAAVVLQNHYRAFLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIKNSTIKIQ
AMWRRYRAKKYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNV
RASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQ
KYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLN
AVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQ
RNRAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKKNDCTKIKAIRLSLQVVN
REIREENKLYKRTALALHYLLTYKHLSAILEALKHLEVVTRLSPLCCENMAQSGAISKIF
VLIRSCNRSIPCMEVIRYAVQVLLNVSKYEKTTSAVYDVENCIDILLELLQIYREKPGNK
VADKGGSIFTKTCCLLAILLKTTNRASDVRSRSKVVDRIYSLYKLTAHKHKMNTERILYK
QKKNSSISIPFIPETPVRTRIVSRLKPDWVLRRDNMEEITNPLQAIQMVMDTLGIPY
NT seq 10434 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccggcgagtggggcgaggctgctgggaagtgagcccgaccgagcggaggccg
cccgcggggctgcggggccccgcggccgaggaggaggcgtcttccccgccggtcctgtct
ctcagccacttctgcaggtctcctttcctttgcttcggggacgttctcctgggagcctca
cggacgctgtctctggccctagacaaccctaacgaggaggtggcagaagtgaagatctcc
cacttcccggccgcggacctgggcttcagtgtgtcgcagcgctgtttcgtgttgcagcct
aaagagaaaattgttatttctgttaactggacaccactcaaagaaggccgagtaagagag
attatgacatttcttgtaaatgatgttctgaaacaccaagctatattactaggaaatgca
gaagagcagaaaaagaaaaagaggagtctttgggataccattaaaaagaagaaaatttca
gcctctacaagtcacaacagaagggtttcaaatattcagaatgttaataaaacatttagt
gtttcccaaaaagttgacagagttaggagcccactacaagcttgtgaaaacttggctatg
aatgaaggcggtcccccaacagaaaacaattctttaatacttgaagaaaataaaataccc
atatcacctattagccctgctttcaatgaatgccatggtgcaacttgcttgccactctct
gtacgtcgatctactacctactcatctcttcatgcatcagaaaatagggaactattaaat
gtacacagtgccaacgtttcaaaagtttcttttaatgagaaagctgtaactgaaacttcc
tttaattccgtaaatgttaatggccaaagaggagagaatagtaaacttagtcttaccccc
aactgttcttcaactttgaacattacacaaagccaaatacattttctaagtccagattct
tttgtaaataatagtcatggagctaataatgaactagaattagtaacatgtctttcatca
gatatgtttatgaaagataattcacagcctgtgcatttggaatcaacaattgcacatgaa
atttatcagaaaattttaagtccagattctttcataaaagataattatggactaaatcag
gatctagaatcagagtcagttaatcctattttatcccctaatcaatttttaaaagataac
atggcatatatgtgtacatctcagcaaacatgtaaagtaccattatcaaatgaaaattct
caagtcccacagtctcctgaagattggagaaaaagtgaagtttcgccacgtattcctgaa
tgtcagggttcaaaatctcccaaagctatttttgaagaactagtagaaatgaagtcaaat
tactacagttttataaaacaaaataatcctaaattttctgcagttcaggatatttctagt
catagccacaataaacaacctaagagacgtccaatactttctgccactgttactaaaagg
aaggccacctgtaccagagaaaaccaaactgagattaataaaccaaaagcaaaaagatgt
ctcaacagtgcagtgggtgaacatgaaaaagtaataaataatcaaaaggaaaaagaagat
tttcattcttatcttccaattatagatccaatattaagtaaatctaagagttataaaaac
gaggtaacaccctcttcgacaacagcttcagttgctcggaaaagaaagagcgatggaagc
atggaagatgcaaatgtgagagttgcaattacagaacatacagaagtgcgagaaatcaaa
agaatccatttttctccctcagagcctaaaacatcagctgttaagaaaacaaaaaatgtg
acaacacccatctcaaaacgtattagcaacagagagaaattaaacctgaagaagaaaact
gatttatcaatattcagaactccaatttctaaaacaaacaaaaggacaaaacccattatc
gctgtggcacagtccagtttgaccttcataaaaccattaaaaacagatattcccagacac
ccgatgccatttgctgcaaaaaacatgttttatgatgaacgctggaaggaaaagcaggaa
cagggcttcacttggtggttaaattttatattaacccctgatgacttcactgtaaaaaca
aatatttctgaagtaaatgctgctactcttcttttgggaatagagaatcaacataaaata
agtgttcctagagcacctacaaaagaggaaatgtctctcagagcttatactgctcggtgt
aggttaaacagactacgtcgtgcagcatgccgtttgtttacttctgaaaaaatggttaaa
gctattaaaaagcttgaaattgaaattgaagctaggcggttaattgttcgaaaagataga
cacctatggaaagatgtgggagaacgtcagaaagtcctgaattggctgttgtcctacaat
cctttgtggcttcgaattggtctagagacaacttatggagaactcatatctttggaagat
aacagtgatgtcacagggttggctatgtttattctgaatcgcctactttggaatcctgat
atagcagctgagtatagacaccccactgttcctcacctgtatagagatggtcatgaagaa
gctttgtccaagtttacattgaaaaagttattgttgttggtctgttttcttgattatgct
aaaatttccagactcattgatcatgatccttgtctcttctgtaaagatgccgaattcaag
gctagtaaagaaatccttttggctttttcacgagatttcctaagtggtgaaggtgacctt
tcccgtcaccttggcttattgggattacctgttaaccatgttcagacaccatttgatgaa
tttgattttgccgttacaaatcttgccgtagacttgcaatgtggagtgcgccttgtgcga
accatggaacttctcacacagaactgggacctctcaaagaaactcaggattccggcaata
agtcgtcttcaaaagatgcacaatgttgacattgttcttcaagttcttaaatcacgagga
attgaattaagtgatgagcatggaaatacaattctatctaaggatattgtggataggcac
agagaaaaaactctcaggttgctttggaaaatagcgtttgcttttcaggtggatatttcc
cttaacttagatcaattaaaggaagaaattgcctttctaaaacacacaaagagtataaag
aaaacaatatctctactatcatgccattctgatgatcttattaataagaaaaaaggcaaa
agggatagtggttcctttgaacaatatagtgaaaacataaagttattgatggattgggta
aatgctgtttgtgccttctataataaaaaggtggagaattttacagtgtctttctcagac
ggccgtgtgttatgttacctgatccaccattaccatccttgctatgtgccatttgacgct
atatgtcagcgtactactcaaactgtggaatgtacgcaaactggttcagtggtattaaat
tcatcatctgaatctgatgacagttctctggatatgtctcttaaagcatttgatcatgaa
aatacttcagagctatacaaagagctcctagaaaatgaaaagaaaaattttcacttggtt
aggtctgcagttagagaccttggtggaatacctgctatgattaatcattcagatatgtca
aatacaattccagatgaaaaggtggttattacctatttgtcatttctttgtgcaaggctt
ttggatcttcgtaaagaaataagagctgctcgactcatacaaacaacatggagaaaatat
aaactaaaaacagatctcaaacgccatcaggagagagagaaagctgcaagaattattcaa
ttggctgtaatcaattttctagcaaaacaaagattgagaaaaagagttaatgcagcactc
gtcattcagaaatattggcgaagagtcttagcacagagaaaattattaatgttaaaaaag
gaaaagctggaaaaagttcaaaataaagcagcatcacttattcagggatattggagaaga
tattccactagacaaagatttctgaaattgaaatattattcaatcatcctgcaatctagg
ataagaatgataattgctgttacatcttataaacgatatctttgggctacagttacaatt
cagaggcattggcgtgcttatttaagaagaaaacaagatcaacaaagatatgaaatgcta
aaatcatcaactcttataatccaatctatgttcagaaaatggaagcaacgtaaaatgcaa
tcacaagtaaaagctacagtaatattgcaaagagcttttagagaatggcatttaagaaaa
caagctaaagaagaaaattctgctattatcatacaatcatggtatagaatgcataaagaa
ttacggaaatatatttatattagatcttgtgttgttatcattcagaaaagatttcggtgc
tttcaagcccaaaagttatataaaagaagaaaagagtccatactaaccatccagaagtac
tacaaagcatatctgaaaggaaagattgagcgcaccaactatttgcagaaacgagctgca
gccattcaattacaagctgcttttaggagactgaaagctcataatttatgtagacaaatt
agagctgcttgtgttattcagtcatactggagaatgagacaagacagagttcgattttta
aaccttaagaagactattatcaaatttcaggcacatgtaagaaaacatcaacaacgacag
aaatataagaagatgaagaaagcagctgttataattcagactcatttccgagcttatatt
tttgccatgaaagttctagcatcttaccagaaaacacgctctgctgtcattgtgctgcag
tctgcatatagagggatgcaagccaggaaaatgtatattcacatcctcacatctgttata
aagattcaatcatattatcgtgcttatgtttctaaaaaggaatttttgagcctaaaaaat
gctacaataaaattgcagtcaactgttaagatgaaacaaacacgtaaacaatatttgcat
ttaagagcagctgcactatttatccagcaatgttaccgttccaaaaaaatagctgcacaa
aagagagaagagtatatgcagatgcgggaatcttgtatcaaactgcaagcatttgttaga
ggataccttgtccgaaagcagatgaggttacaaagaaaagctgttatttcactacagtct
tatttcagaatgagaaaggctcggcagtattatctgaaaatgtataaagcaattattgtc
attcagaattactatcatgcatacaaagcacaggtcaatcagaggaagaacttcttgcaa
gtcaaaaaagcagctacttgcttgcaagcagcttacagaggttataaagtacgccagcta
atcaaacaacaatctatagctgctcttaaaattcagtctgcttttagaggctataataaa
agggtaaaatatcaatctgtgcttcaatctataataaagattcagagatggtacagggcg
tacaagactcttcatgatacaagaacacattttttgaagacaaaggcagctgtgatttcc
ctccagtctgcttatcgtggctggaaggttcggaaacagattagaagggaacatcaagct
gccttgaagattcagtctgcttttagaatggccaaggcccagaaacagtttagattgttt
aaaacagcagcattagtcatccagcaaaatttcagagcatggactgcaggaaggaagcaa
tgtatggagtatattgaactccgtcatgcggtactggtgcttcaatctatgtggaaggga
aaaacactgagaagacagcttcaaaggcaacataaatgtgctatcatcatacagtcatac
tatagaatgcatgtgcaacaaaagaagtggaaaatcatgaaaaaagctgctcttctgatt
caaaagtattatagggcttacagtattggaagagaacagaatcatttatatttgaaaaca
aaagcagctgtagtaactttacagtcagcttatcgtggtatgaaagtgagaaaaagaata
aaggattgcaacaaagcagcagtcactatacagtctaaatacagagcttacaaaaccaaa
aagaaatatgcaacctatagagcttcagctattataattcagagatggtatcgaggtatt
aaaattacaaaccatcagcataaggagtatcttaatttgaagaagacagcaattaaaatc
caatctgtttatagaggtattagagttagaagacatattcaacacatgcacagggcagcc
acttttattaaagccatgtttaaaatgcatcagtcaagaataagttaccatacaatgaga
aaagcagctattgttattcaagtaagatgtagagcatattatcaaggtaaaatgcagcgt
gaaaagtacctgacaattttgaaagctgttaaagtccttcaggcaagttttagaggagta
agagttagacggactcttagaaagatgcagactgcagcaacactcattcagtcaaactac
agaagatacagacagcaaacatactttaataagttaaagaaaataacaaaaacagtacag
caaagatactgggcaatgaaagaaagaaacatacaatttcaaaggtataacaaactgagg
cattctgtaatatacattcaggctatttttaggggaaagaaagctagaagacatttaaaa
atgatgcatatagccgcaactctcattcagaggagatttagaactctaatgatgagaaga
agattcctctctctcaagaaaactgctattttgattcagagaaaatatcgggcacatctt
tgtacaaagcatcacttacagttccttcaggtacaaaatgcagttattaaaatccagtca
tcatacagaagatggatgataaggaaaaggatgcgagagatgcacagggctgctactttc
atccagtctactttcagaatgcacagattacatatgagatatcaggctttgaaacaggcc
tccgttgtgatccaacagcaataccaagcaaatagagctgcaaaactgcagaggcagcat
tatctcagacaaagacactctgctgtgatccttcaggctgcattcaggggtatgaaaact
agaagacatttgaagagtatgcattcctctgcaacccttattcagagtaggtttagatca
ttactggtgaggagaagattcatttccctcaaaaaagctactatttttgttcagaggaaa
tatcgagccaccatttgtgccaaacataaattgtaccaattcttgcacttaagaaaggca
gccattacaatacagtcatcttacagaagactgatggtaaagaagaagttacaagaaatg
caaagggctgcagttctcattcaggctactttcaggatgtacagaacatatattacattt
cagacttggaaacatgcttcaattctaattcagcaacattatcgaacatatagagctgca
aaattacaaagagaaaattatatcagacaatggcattctgctgtggttattcaggctgca
tataaaggaatgaaagcaagacaacttttaagggaaaaacacaaagcttctatcgtaata
caaagcacctacagaatgtataggcagtattgtttctaccaaaagcttcagtgggctaca
aaaatcatacaagaaaaatatagagcaaataaaaagaaacagaaagtatttcaacacaat
gaacttaagaaagagacttgtgttcaggcaggttttcaggacatgaacataaaaaaacag
attcaggaacagcaccaggctgccattattattcagaagcattgtaaagcctttaaaata
aggaagcattatctccaccttagagcaacagtagtttctattcaaagaagatacagaaaa
ctaactgcagtgcgtacccaagcagttatttgtatacagtcttattacagaggctttaaa
gtacgaaaggatattcaaaatatgcaccgggctgccacactaattcagtcattctatcga
atgcacagggccaaagttgattatgaaacaaagaaaactgcaattgtggttatacagaat
tattataggttgtatgttagagtaaaaacagaaagaaaaaactttttagcagttcagaaa
tctgtacgaactattcaggctgcttttagaggcatgaaagttagacaaaaattgaaaaat
gtatcagaggaaaagatggcagccattgttaaccaatctgcactctgctgttacagaagt
aaaactcagtatgaagctgttcaaagtgaaggtgttatgattcaagagtggtataaagct
tctggccttgcttgttcacaggaagcagagtatcattctcaaagtagggctgcagtaaca
attcaaaaagctttttgtagaatggtcacaagaaaactggaaacacagaaatgtgctgcc
ctacggattcagttcttccttcagatggctgtgtatcggagaagatttgttcagcagaaa
agagctgctatcactttacagcattattttaggacgtggcaaaccagaaaacagttttta
ctatatagaaaagcagcagtggttttacaaaatcactacagagcatttctgtctgcaaaa
catcaaagacaagtctatttacagatcagaagcagtgttatcattattcaagctagaagt
aaaggatttatacagaaacggaagtttcaggaaattaaaaatagcaccataaaaattcag
gctatgtggaggagatatagagccaagaaatatttatgtaaagtgaaagctgcctgcaag
attcaagcctggtatagatgttggagagcacacaaagaatatctagctatattaaaagct
gttaaaattattcaaggttgcttctataccaaactagagagaacacggtttttgaatgtg
agagcatcagcaattatcattcagagaaaatggagagctatacttcctgcaaagatagct
catgaacacttcttaatgataaaaagacatcgagctgcttgtttgatccaagcacattat
agaggatataaaggaaggcaggtctttcttcggcagaaatctgctgctttgatcatacaa
aaatatatacgagccagggaggctggaaagcatgaaaggataaaatatattgaatttaaa
aaatctacagttatcctacaagcactggtgcgtggttggctagtacgaaaaagattttta
gaacagagagccaaaattcgacttcttcacttcactgcagctgcatattatcacctgaat
gctgttagaattcaaagagcctataaactttacctggctgtgaagaatgctaacaagcag
gttaattcagtcatctgtattcagagatggtttcgagcaagattacaagaaaagagattt
attcagaaatatcatagcatcaaaaagattgagcatgaaggtcaagaatgtctgagccag
cgaaatagggctgcatcagtaatacagaaagcagtgcgccattttctcctccgtaaaaag
caggaaaaattcactagtggaatcattaaaattcaggcattatggagaggctattcttgg
aggaagaaaaatgattgtacaaaaattaaagctatacgactaagtcttcaagttgttaat
agggagattcgagaagaaaacaaactctacaaaagaactgcacttgcacttcattacctt
ttgacatataagcacctttctgccattcttgaggccttaaaacacctagaggtagttact
agattgtctccactttgttgtgagaacatggcccagagtggagcaatttctaaaatattt
gttttgatccgaagttgtaatcgcagtattccttgtatggaagtcatcagatatgctgtg
caagtcttgcttaatgtatctaagtatgagaaaactacttcagcagtttatgatgtagaa
aattgtatagatatactattggagcttttgcagatataccgagaaaagcctggtaataaa
gttgcagacaaaggcggaagcatttttacaaaaacttgttgtttgttggctattttactg
aagacaacaaatagagcctctgatgtacgaagtaggtccaaagttgttgaccgtatttac
agtctctacaaacttacagctcataaacataaaatgaatactgaaagaatactttacaag
caaaagaagaattcttctataagcattccttttatcccagaaacacctgtaaggaccaga
atagtttcaagacttaagccagattgggttttgagaagagataacatggaagaaatcaca
aatcccctgcaagctattcaaatggtgatggatacgcttggcattccttattag

DBGET integrated database retrieval system