KEGG   Homo sapiens (human): 25928
Entry
25928             CDS       T01001                                 

Gene name
SOSTDC1, CDA019, DAND7, ECTODIN, USAG1
Definition
(RefSeq) sclerostin domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Sclerostin DAN Cys_knot
Other DBs
NCBI-GeneID: 25928
NCBI-ProteinID: NP_056279
OMIM: 609675
HGNC: 21748
Ensembl: ENSG00000171243
Vega: OTTHUMG00000090807
Pharos: Q6X4U4(Tbio)
UniProt: Q6X4U4 A4D125
Position
7p21.2
AA seq 206 aa
MLPPAIHFYLLPLACILMKSCLAFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHF
SNTGLDRNTRVQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGT
KYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFE
SMSPAKPVQHHRERKRASKSSKHSMS
NT seq 621 nt   +upstreamnt  +downstreamnt
atgcttcctcctgccattcatttctatctccttccccttgcatgcatcctaatgaaaagc
tgtttggcttttaaaaatgatgccacagaaatcctttattcacatgtggttaaacctgtt
ccagcacaccccagcagcaacagcacgttgaatcaagccagaaatggaggcaggcatttc
agtaacactggactggatcggaacactcgggttcaagtgggttgccgggaactgcgttcc
accaaatacatctctgatggccagtgcaccagcatcagccctctgaaggagctggtgtgt
gctggcgagtgcttgcccctgccagtgctccctaactggattggaggaggctatggaaca
aagtactggagcaggaggagctcccaggagtggcggtgtgtcaatgacaaaacccgtacc
cagagaatccagctgcagtgccaagatggcagcacacgcacctacaaaatcacagtagtc
actgcctgcaagtgcaagaggtacacccggcagcacaacgagtccagtcacaactttgag
agcatgtcacctgccaagccagtccagcatcacagagagcggaaaagagccagcaaatcc
agcaagcacagcatgagttag

DBGET integrated database retrieval system