KEGG   Homo sapiens (human): 25929Help
Entry
25929             CDS       T01001                                 

Gene name
GEMIN5, GEMIN-5
Definition
(RefSeq) gem nuclear organelle associated protein 5
  KO
K13133  gem associated protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Module
hsa_M00426  Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    25929 (GEMIN5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    25929 (GEMIN5)
   03041 Spliceosome [BR:hsa03041]
    25929 (GEMIN5)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     25929 (GEMIN5)
   mRNA cycle factors
    P-body specific factors
     25929 (GEMIN5)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    25929 (GEMIN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 25929
NCBI-ProteinID: NP_056280
OMIM: 607005
HGNC: 20043
Ensembl: ENSG00000082516
Vega: OTTHUMG00000130189
Pharos: Q8TEQ6(Tbio)
UniProt: Q8TEQ6 Q58EZ8
Structure
PDB: 

Position
5q33.2
AA seq 1508 aa AA seqDB search
MGQEPRTLPPSPNWYCARCSDAVPGGLFGFAARTSVFLVRVGPGAGESPGTPPFRVIGEL
VGHTERVSGFTFSHHPGQYNLCATSSDDGTVKIWDVETKTVVTEHALHQHTISTLHWSPR
VKDLIVSGDEKGVVFCYWFNRNDSQHLFIEPRTIFCLTCSPHHEDLVAIGYKDGIVVIID
ISKKGEVIHRLRGHDDEIHSIAWCPLPGEDCLSINQEETSEEAEITNGNAVAQAPVTKGC
YLATGSKDQTIRIWSCSRGRGVMILKLPFLKRRGGGIDPTVKERLWLTLHWPSNQPTQLV
SSCFGGELLQWDLTQSWRRKYTLFSASSEGQNHSRIVFNLCPLQTEDDKQLLLSTSMDRD
VKCWDIATLECSWTLPSLGGFAYSLAFSSVDIGSLAIGVGDGMIRVWNTLSIKNNYDVKN
FWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSNKPPQISSTYHKKTVYTLAWGP
PVPPMSLGGEGDRPSLALYSCGGEGIVLQHNPWKLSGEAFDINKLIRDTNSIKYKLPVHT
EISWKADGKIMALGNEDGSIEIFQIPNLKLICTIQQHHKLVNTISWHHEHGSQPELSYLM
ASGSNNAVIYVHNLKTVIESSPESPVTITEPYRTLSGHTAKITSVAWSPHHDGRLVSASY
DGTAQVWDALREEPLCNFRGHRGRLLCVAWSPLDPDCIYSGADDFCVHKWLTSMQDHSRP
PQGKKSIELEKKRLSQPKAKPKKKKKPTLRTPVKLESIDGNEEESMKENSGPVENGVSDQ
EGEEQAREPELPCGLAPAVSREPVICTPVSSGFEKSKVTINNKVILLKKEPPKEKPETLI
KKRKARSLLPLSTSLDHRSKEELHQDCLVLATAKHSRELNEDVSADVEERFHLGLFTDRA
TLYRMIDIEGKGHLENGHPELFHQLMLWKGDLKGVLQTAAERGELTDNLVAMAPAAGYHV
WLWAVEAFAKQLCFQDQYVKAASHLLSIHKVYEAVELLKSNHFYREAIAIAKARLRPEDP
VLKDLYLSWGTVLERDGHYAVAAKCYLGATCAYDAAKVLAKKGDAASLRTAAELAAIVGE
DELSASLALRCAQELLLANNWVGAQEALQLHESLQGQRLVFCLLELLSRHLEEKQLSEGK
SSSSYHTWNTGTEGPFVERVTAVWKSIFSLDTPEQYQEAFQKLQNIKYPSATNNTPAKQL
LLHICHDLTLAVLSQQMASWDEAVQALLRAVVRSYDSGSFTIMQEVYSAFLPDGCDHLRD
KLGDHQSPATPAFKSLEAFFLYGRLYEFWWSLSRPCPNSSVWVRAGHRTLSVEPSQQLDT
ASTEETDPETSQPEPNRPSELDLRLTEEGERMLSTFKELFSEKHASLQNSQRTVAEVQET
LAEMIRQHQKSQLCKSTANGPDKNEPEVEAEQPLCSSQSQCKEEKNEPLSLPELTKRLTE
ANQRMAKFPESIKAWPFPDVLECCLVLLLIRSHFPGCLAQEMQQQAQELLQKYGNTKTYR
RHCQTFCM
NT seq 4527 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggagccgcggacgctgccgccctcccccaactggtactgcgcccgctgcagc
gatgccgtgcccgggggcctctttggcttcgccgcgcggacctccgtcttccttgtccgc
gtgggcccgggcgcaggcgagagtccagggacacccccgtttcgagtcataggagagttg
gtgggacacaccgaaagggtctctggcttcacattttctcatcaccctggtcagtacaac
ctctgtgccaccagctccgacgatgggactgtgaaaatatgggatgtagagacaaaaaca
gttgtgacagaacatgcactccatcagcatacgatatcaacattacattggtctcctcga
gtaaaggacttaatagtatctggggatgaaaaaggagtagttttctgttactggtttaac
agaaatgacagccagcacctctttatagaacccaggacaattttctgtcttacttgttca
cctcatcatgaagatttagtagccattggctacaaggatggcatagtggtgataattgac
atcagtaagaaaggagaagttattcataggcttcgaggccatgatgatgaaatccactcc
atagcctggtgtcccctgcctggtgaagattgtttatctataaaccaagaggaaacttca
gaagaagctgaaattaccaacgggaatgctgtagcacaagctccagtaacaaaaggttgc
tacttagccactggaagcaaagatcaaaccattcgaatctggagctgttctagaggccga
ggggtgatgattttgaaattgccctttctgaagagaagaggagggggtatagacccaact
gttaaagagcgcctttggttgacactccattggcccagcaatcaaccaacacagctggta
tctagctgttttggaggtgaactgttgcaatgggatctcactcaatcttggagacggaaa
tacaccctcttcagtgcctcatcagaagggcaaaatcattcaagaattgtgtttaattta
tgtcctttacaaacagaggatgacaaacagctattactttctacatcaatggatagagat
gtaaaatgttgggacatagccaccttggagtgcagctggacccttccttcccttggtggg
tttgcatacagcctggctttctcttctgtggacataggctctttggccataggtgttggg
gatggcatgatccgtgtatggaatacactctccataaagaacaactatgatgtgaaaaat
ttttggcaaggcgtgaagtccaaggttacagcgctgtgctggcacccaaccaaggaaggt
tgcttagcttttggaactgatgatggaaaagtgggattgtatgacacctactccaacaag
cctccacagatttctagcacatatcataagaagactgtatatactttagcctgggggcca
ccagtaccccccatgtcacttggaggagaaggagacagaccttcccttgctttatacagc
tgtggaggagaagggattgtcttacagcataatccctggaagcttagtggagaagccttt
gacatcaacaaactcatcagggacaccaattcaatcaaatacaaattgcctgtacacaca
gagataagttggaaagcagatggcaaaatcatggctcttggcaatgaagatggatcaata
gaaatatttcagattcccaacctgaaactgatctgtactatccaacagcatcacaagctt
gtgaataccattagctggcatcatgagcatggcagccagccagaattgagctatctgatg
gcctctggctccaacaatgcagtcatttacgtgcacaacctgaagactgtcatagagagc
agccctgagtctccagtgaccattacagagccctaccggaccctctcagggcatacggcc
aagattaccagtgtggcgtggagcccacatcatgatggaaggctggtatctgcttcctat
gatggtacagcccaggtgtgggatgctctccgggaagagcccctgtgcaatttccgagga
catcgaggtcgactgctttgtgtggcatggtctcctttggatccagactgcatctattca
ggggcagatgacttttgtgtgcacaagtggctcacttccatgcaagatcattcccggcct
cctcaaggcaaaaaaagtattgaattggagaaaaaacggctctctcaacctaaggcaaag
cccaaaaagaagaaaaagcccaccttgagaactcctgtaaagctggaatcgattgatgga
aatgaagaagaaagcatgaaggagaactcaggacctgttgagaatggtgtgtcagaccaa
gaaggggaggagcaagcacgggagccggaattaccctgtggccttgctccagcggtttct
agagaaccagttatctgcactccagtttcctcaggctttgaaaagtcaaaagtcaccatt
aataacaaagtcattttactgaaaaaggagccaccaaaagagaagccagaaaccttaatc
aagaagagaaaagctcgttccttgcttcccctgagtacaagcctggaccacagatccaaa
gaggagcttcatcaggactgtttggtactagcaactgcaaagcactccagagagctgaat
gaagatgtgtctgctgatgttgaggaaagatttcatctggggcttttcacagacagggct
accctgtatagaatgattgatattgaaggaaaaggtcacttagaaaatggccaccctgag
ttatttcaccagcttatgctttggaaaggagatctcaaaggtgttctccagactgcagca
gaaagaggggagctgacagacaaccttgtggctatggcaccagcagctggctaccatgtg
tggctatgggctgtggaagcttttgccaaacagctgtgttttcaggatcagtatgtcaag
gctgcttctcacctactttccatccacaaagtgtatgaagcggtggagctgctcaagtca
aaccatttttacagggaagctattgcgattgccaaggcccggctgcgcccggaggaccca
gtcctgaaggacttgtacctcagctggggaaccgtcctagaaagagatggccactatgct
gtagctgccaaatgctatttaggggccacttgtgcttatgatgcagccaaagttttggcc
aaaaagggggatgcggcatcacttagaacggctgcagagttggctgccatcgtaggagag
gatgagttgtctgcttccctggctctcagatgtgcccaagagctgcttctggccaacaac
tgggtgggagcccaggaagccctgcagctgcatgaaagtctacagggtcagagattggtg
ttttgccttctggagctactgtccaggcatctggaggaaaagcagctttcagagggcaaa
agctcctcctcttaccacacttggaacacgggcaccgaagggcctttcgtggagagggtg
actgcagtgtggaagagcatcttcagccttgacacccctgagcagtatcaggaagccttt
cagaagctgcagaacatcaagtacccatctgctacaaataacacacctgccaaacagctc
ctgcttcacatttgccatgacttgaccctggcagtgctgagccaacagatggcctcctgg
gacgaggctgtgcaggcgctccttcgggcggtggtccggagctatgactcagggagcttc
accatcatgcaggaagtgtactcagcctttctccctgacggctgtgaccacctaagagac
aagttgggggaccatcaatcccctgccacaccagctttcaaaagtttggaggcctttttt
ctttatgggcgtctgtatgaattctggtggtctctctccagaccttgcccaaattccagt
gtctgggtaagggctggtcacagaacactctctgttgagccaagccagcagttagacact
gccagcactgaagaaacggaccctgaaacttctcagccagagccaaacaggccttcagaa
ctagacttgagactcacagaagaaggtgagcgaatgctgagtacttttaaggagctcttt
tcagaaaagcatgccagtctccaaaactcacagagaactgttgctgaagtccaagagacc
ttggcagaaatgatccgacaacaccaaaagagtcaactctgtaaatccacagcaaatggt
cctgataagaatgaaccggaagtagaagcagagcagcccctctgcagttctcagagccag
tgtaaagaagaaaaaaatgagccactttctctgcctgagttaaccaaaaggcttaccgag
gcaaatcagagaatggcgaaatttcctgagagcattaaggcctggcccttcccagatgtg
ctggagtgctgcctcgtcctgcttctcatcaggtcccactttcctggctgtctggcccag
gaaatgcagcagcaggcccaagagctccttcagaaatacggcaacacgaaaacttacaga
agacactgccagaccttctgtatgtga

DBGET integrated database retrieval system