KEGG   Homo sapiens (human): 259292
Entry
259292            CDS       T01001                                 

Gene name
TAS2R46, T2R46, T2R54
Definition
(RefSeq) taste 2 receptor member 46
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    259292 (TAS2R46)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259292 (TAS2R46)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    259292 (TAS2R46)
SSDB
Motif
Pfam: TAS2R PAG
Other DBs
NCBI-GeneID: 259292
NCBI-ProteinID: NP_795368
OMIM: 612774
HGNC: 18877
Ensembl: ENSG00000226761
Vega: OTTHUMG00000165351
Pharos: P59540(Tbio)
UniProt: P59540
Position
12p13.2
AA seq 309 aa
MITFLPIIFSILIVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLW
VLVLNWYATELNPAFNSIEVRITAYNVWAVINHFSNWLATSLSIFYLLKIANFSNLIFLH
LKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNTTVT
ILANLVPFTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSMKVHIKALQTVTSFLLLCAI
YFLSIIMSVWSFESLENKPVFMFCEAIAFSYPSTHPFILIWGNKKLKQTFLSVLWHVRYW
VKGEKPSSS
NT seq 930 nt   +upstreamnt  +downstreamnt
atgataacttttctgcccatcattttttccattctaatagtggttacatttgtgattgga
aattttgctaatggcttcatagcattggtaaattccattgagtggttcaagagacaaaag
atctcttttgctgaccaaattctcactgctctggcagtctccagagttggtttactctgg
gtattagtattaaattggtatgcaactgagttgaatccagcttttaacagtatagaagta
agaattactgcttacaatgtctgggcagtaatcaaccatttcagcaactggcttgctact
agcctcagcatattttatttgctcaagattgccaatttctccaaccttatttttcttcac
ttaaagaggagagttaagagtgttgttctggtgatactattggggcctttgctatttttg
gtttgtcatctttttgtgataaacatgaatcagattatatggacaaaagaatatgaagga
aacatgacttggaagatcaaactgaggagtgcaatgtacctttcaaatacaacggtaacc
atcctagcaaacttagttcccttcactctgaccctgatatcttttctgctgttaatctgt
tctctgtgtaaacatctcaaaaagatgcagctccatggcaaaggatctcaagatcccagc
atgaaggtccacataaaagctttgcaaactgtgacctccttcctcttgttatgtgccatt
tactttctgtccataatcatgtcagtttggagttttgagagtctggaaaacaaacctgtc
ttcatgttctgcgaagctattgcattcagctatccttcaacccacccattcatcctgatt
tggggaaacaagaagctaaagcagacttttctttcagttttgtggcatgtgaggtactgg
gtgaaaggagagaagccttcatcttcatag

DBGET integrated database retrieval system