KEGG   Homo sapiens (human): 259296
Entry
259296            CDS       T01001                                 

Gene name
TAS2R50, T2R50, T2R51, TAS2R51
Definition
(RefSeq) taste 2 receptor member 50
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    259296 (TAS2R50)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259296 (TAS2R50)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    259296 (TAS2R50)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 259296
NCBI-ProteinID: NP_795371
OMIM: 609627
HGNC: 18882
Ensembl: ENSG00000212126
Vega: OTTHUMG00000162719
Pharos: P59544(Tbio)
UniProt: P59544
Position
12p13.2
AA seq 299 aa
MITFLYIFFSILIMVLFVLGNFANGFIALVNFIDWVKRKKISSADQILTALAVSRIGLLW
ALLLNWYLTVLNPAFYSVELRITSYNAWVVTNHFSMWLAANLSIFYLLKIANFSNLLFLH
LKRRVRSVILVILLGTLIFLVCHLLVANMDESMWAEEYEGNMTGKMKLRNTVHLSYLTVT
TLWSFIPFTLSLISFLMLICSLCKHLKKMQLHGEGSQDLSTKVHIKALQTLISFLLLCAI
FFLFLIVSVWSPRRLRNDPVVMVSKAVGNIYLAFDSFILIWRTKKLKHTFLLILCQIRC
NT seq 900 nt   +upstreamnt  +downstreamnt
atgataacttttctatacatttttttttcaattctaataatggttttatttgttctcgga
aactttgccaatggcttcatagcactggtaaatttcattgactgggtgaagagaaaaaag
atctcctcagctgaccaaattctcactgctctggcggtctccagaattggtttgctctgg
gcattattattaaattggtatttaactgtgttgaatccagctttttatagtgtagaatta
agaattacttcttataatgcctgggttgtaaccaaccatttcagcatgtggcttgctgct
aacctcagcatattttatttgctcaagattgccaatttctccaaccttctttttcttcat
ttaaagaggagagttaggagtgtcattctggtgatactgttggggactttgatatttttg
gtttgtcatcttcttgtggcaaacatggatgagagtatgtgggcagaagaatatgaagga
aacatgactgggaagatgaaattgaggaatacagtacatctttcatatttgactgtaact
accctatggagcttcataccctttactctgtccctgatatcttttctgatgctaatctgt
tctctgtgtaaacatctcaagaagatgcagctccatggagaaggatcgcaagatctcagc
accaaggtccacataaaagctttgcaaactctgatctccttcctcttgttatgtgccatt
ttctttctattcctaatcgtttcggtttggagtcctaggaggctgcggaatgacccggtt
gtcatggttagcaaggctgttggaaacatatatcttgcattcgactcattcatcctaatt
tggagaaccaagaagctaaaacacacctttcttttgattttgtgtcagattaggtgctga

DBGET integrated database retrieval system