KEGG   Homo sapiens (human): 259307Help
Entry
259307            CDS       T01001                                 

Gene name
IL4I1, FIG1, LAAO, LAO
Definition
(RefSeq) interleukin 4 induced 1
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa00270  Cysteine and methionine metabolism
hsa00280  Valine, leucine and isoleucine degradation
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa00380  Tryptophan metabolism
hsa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    259307 (IL4I1)
   00270 Cysteine and methionine metabolism
    259307 (IL4I1)
   00280 Valine, leucine and isoleucine degradation
    259307 (IL4I1)
   00350 Tyrosine metabolism
    259307 (IL4I1)
   00360 Phenylalanine metabolism
    259307 (IL4I1)
   00380 Tryptophan metabolism
    259307 (IL4I1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    259307 (IL4I1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     259307 (IL4I1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 DAO HI0933_like FAD_binding_2 Pyr_redox AlaDh_PNT_C FAD_binding_3 Thi4 FAD_oxidored GIDA Pyr_redox_3 MCRA Lycopene_cycl UDPG_MGDP_dh_N 3HCDH_N FMO-like DUF1188 NAD_binding_7 DUF4264 Shikimate_DH Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 259307
NCBI-ProteinID: NP_690863
OMIM: 609742
HGNC: 19094
Ensembl: ENSG00000104951
Vega: OTTHUMG00000183377
Pharos: Q96RQ9(Tbio)
UniProt: Q96RQ9
Position
19q13.33
AA seq 567 aa AA seqDB search
MAPLALHLLVLVPILLSLVASQDWKAERSQDPFEKCMQDPDYEQLLKVVTWGLNRTLKPQ
RVIVVGAGVAGLVAAKVLSDAGHKVTILEADNRIGGRIFTYRDQNTGWIGELGAMRMPSS
HRILHKLCQGLGLNLTKFTQYDKNTWTEVHEVKLRNYVVEKVPEKLGYALRPQEKGHSPE
DIYQMALNQALKDLKALGCRKAMKKFERHTLLEYLLGEGNLSRPAVQLLGDVMSEDGFFY
LSFAEALRAHSCLSDRLQYSRIVGGWDLLPRALLSSLSGLVLLNAPVVAMTQGPHDVHVQ
IETSPPARNLKVLKADVVLLTASGPAVKRITFSPPLPRHMQEALRRLHYVPATKVFLSFR
RPFWREEHIEGGHSNTDRPSRMIFYPPPREGALLLASYTWSDAAAAFAGLSREEALRLAL
DDVAALHGPVVRQLWDGTGVVKRWAEDQHSQGGFVVQPPALWQTEKDDWTVPYGRIYFAG
EHTAYPHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVASSPSHD
LAKEEGSHPPVQGQLSLQNTTHTRTSH
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggccccattggccctgcacctcctcgtcctcgtccccatcctcctcagcctggtggcc
tcccaggactggaaggctgaacgcagccaagaccccttcgagaaatgcatgcaggatcct
gactatgagcagctgctcaaggtggtgacctgggggctcaatcggaccctgaagccccag
agggtgattgtggttggcgctggtgtggccgggctggtggccgccaaggtgctcagcgat
gctggacacaaggtcaccatcctggaggcagataacaggatcgggggccgcatcttcacc
taccgggaccagaacacgggctggattggggagctgggagccatgcgcatgcccagctct
cacaggatcctccacaagctctgccagggcctggggctcaacctgaccaagttcacccag
tacgacaagaacacgtggacggaggtgcacgaagtgaagctgcgcaactatgtggtggag
aaggtgcccgagaagctgggctacgccttgcgtccccaggaaaagggccactcgcccgaa
gacatctaccagatggctctcaaccaggccctcaaagacctcaaggcactgggctgcaga
aaggcgatgaagaagtttgaaaggcacacgctcttggaatatcttctcggggaggggaac
ctgagccggccggccgtgcagcttctgggagacgtgatgtccgaggatggcttcttctat
ctcagcttcgccgaggccctccgggcccacagctgcctcagcgacagactccagtacagc
cgcatcgtgggtggctgggacctgctgccgcgcgcgctgctgagctcgctgtccgggctt
gtgctgttgaacgcgcccgtggtggcgatgacccagggaccgcacgatgtgcacgtgcag
atcgagacctctcccccggcgcggaatctgaaggtgctgaaggccgacgtggtgctgctg
acggcgagcggaccggcggtgaagcgcatcaccttctcgccgccgctgccccgccacatg
caggaggcgctgcggaggctgcactacgtgccggccaccaaggtgttcctaagcttccgc
aggcccttctggcgcgaggagcacattgaaggcggccactcaaacaccgatcgcccgtcg
cgcatgattttctacccgccgccgcgcgagggcgcgctgctgctggcctcgtacacgtgg
tcggacgcggcggcagcgttcgccggcttgagccgggaagaggcgttgcgcttggcgctc
gacgacgtggcggcattgcacgggcctgtcgtgcgccagctctgggacggcaccggcgtc
gtcaagcgttgggcggaggaccagcacagccagggtggctttgtggtacagccgccggcg
ctctggcaaaccgaaaaggatgactggacggtcccttatggccgcatctactttgccggc
gagcacaccgcctacccgcacggctgggtggagacggcggtcaagtcggcgctgcgcgcc
gccatcaagatcaacagccggaaggggcctgcatcggacacggccagccccgaggggcac
gcatctgacatggaggggcaggggcatgtgcatggggtggccagcagcccctcgcatgac
ctggcaaaggaagaaggcagccaccctccagtccaaggccagttatctctccaaaacacg
acccacacgaggacctcgcattaa

DBGET integrated database retrieval system