KEGG   Homo sapiens (human): 25932
Entry
25932             CDS       T01001                                 

Symbol
CLIC4, CLIC4L, H1, MTCLIC, huH1, p64H1
Name
(RefSeq) chloride intracellular channel 4
  KO
K05024  chloride intracellular channel protein 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    25932 (CLIC4)
   04040 Ion channels [BR:hsa04040]
    25932 (CLIC4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25932 (CLIC4)
  Exosomal proteins of colorectal cancer cells
   25932 (CLIC4)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel, intracellular (CLIC)
   25932 (CLIC4)
SSDB
Motif
Pfam: GST_C_2 GST_N_2 GST_N_3 GST_C GST_C_3
Other DBs
NCBI-GeneID: 25932
NCBI-ProteinID: NP_039234
OMIM: 606536
HGNC: 13518
Ensembl: ENSG00000169504
Vega: OTTHUMG00000003327
Pharos: Q9Y696(Tbio)
UniProt: Q9Y696 Q6FIC5
Structure
PDB: 
2AHE 2D2Z

Position
1p36.11
AA seq 253 aa
MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLK
RKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMD
IFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLD
GNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEV
EIAYSDVAKRLTK
NT seq 762 nt   +upstreamnt  +downstreamnt
atggcgttgtcgatgccgctgaatgggctgaaggaggaggacaaagagcccctcatcgag
ctcttcgtcaaggctggcagtgatggtgaaagcataggaaactgccccttttcccagagg
ctcttcatgattctttggctcaaaggagttgtatttagtgtgacgactgttgacctgaaa
aggaagccagcagacctgcagaacttggctcccgggacccacccaccatttataactttc
aacagtgaagtcaaaacggatgtaaataagattgaggaatttcttgaagaagtcttatgc
cctcccaagtacttaaagctttcaccaaaacacccagaatcaaatactgctggaatggac
atctttgccaaattctctgcatatatcaagaattcaaggccagaggctaatgaagcactg
gagaggggtctcctgaaaaccctgcagaaactggatgaatatctgaattctcctctccct
gatgaaattgatgaaaatagtatggaggacataaagttttctacacgtaaatttctggat
ggcaatgaaatgacattagctgattgcaacctgctgcccaaactgcatattgtcaaggtg
gtggccaaaaaatatcgcaactttgatattccaaaagaaatgactggcatctggagatac
ctaactaatgcatacagtagggacgagttcaccaatacctgtcccagtgataaggaggtt
gaaatagcatatagtgatgtagccaaaagactcaccaagtaa

DBGET integrated database retrieval system