KEGG   Homo sapiens (human): 25937Help
Entry
25937             CDS       T01001                                 

Gene name
WWTR1, TAZ
Definition
(RefSeq) WW domain containing transcription regulator 1
  KO
K16820  WW domain-containing transcription regulator protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    25937 (WWTR1)
   04392 Hippo signaling pathway - multiple species
    25937 (WWTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WW
Motif
Other DBs
NCBI-GeneID: 25937
NCBI-ProteinID: NP_001161750
OMIM: 607392
HGNC: 24042
Ensembl: ENSG00000018408
Vega: OTTHUMG00000159614
Pharos: Q9GZV5(Tbio)
UniProt: Q9GZV5
Position
3q25.1
AA seq 400 aa AA seqDB search
MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGS
HSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDV
TDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQR
SMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRI
QMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFL
NGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDF
LDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaatccggcctcggcgccccctccgctcccgccgcctgggcagcaagtgatccacgtc
acgcaggacctagacacagacctcgaagccctcttcaactctgtcatgaatccgaagcct
agctcgtggcggaagaagatcctgccggagtctttctttaaggagcctgattcgggctcg
cactcgcgccagtccagcaccgactcgtcgggcggccacccggggcctcgactggctggg
ggtgcccagcatgtccgctcgcactcgtcgcccgcgtccctgcagctgggcaccggcgcg
ggtgctgcgggtagccccgcgcagcagcacgcgcacctccgccagcagtcctacgacgtg
accgacgagctgccactgcccccgggctgggagatgaccttcacggccactggccagagg
tacttcctcaatcacatagaaaaaatcaccacatggcaagaccctaggaaggcgatgaat
cagcctctgaatcatatgaacctccaccctgccgtcagttccacaccagtgcctcagagg
tccatggcagtatcccagccaaatctcgtgatgaatcaccaacaccagcagcagatggcc
cccagtaccctgagccagcagaaccaccccactcagaacccacccgcagggctcatgagt
atgcccaatgcgctgaccactcagcagcagcagcagcagaaactgcggcttcagagaatc
cagatggagagagaaaggattcgaatgcgccaagaggagctcatgaggcaggaagctgcc
ctctgtcgacagctccccatggaagctgagactcttgccccagttcaggctgctgtcaac
ccacccacgatgaccccagacatgagatccatcactaataatagctcagatcctttcctc
aatggagggccatatcattcgagggagcagagcactgacagtggcctggggttagggtgc
tacagtgtccccacaactccggaggacttcctcagcaatgtggatgagatggatacagga
gaaaacgcaggacaaacacccatgaacatcaatccccaacagacccgtttccctgatttc
cttgactgtcttccaggaacaaacgttgacttaggaactttggaatctgaagacctgatc
cccctcttcaatgatgtagagtctgctctgaacaaaagtgagccctttctaacctggctg
taa

DBGET integrated database retrieval system