KEGG   Homo sapiens (human): 25945
Entry
25945             CDS       T01001                                 

Gene name
NECTIN3, CD113, CDW113, NECTIN-3, PPR3, PRR3, PVRL3, PVRR3
Definition
(RefSeq) nectin cell adhesion molecule 3
  KO
K06592  poliovirus receptor-related protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    25945 (NECTIN3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    25945 (NECTIN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    25945 (NECTIN3)
   04090 CD molecules [BR:hsa04090]
    25945 (NECTIN3)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  Nectin family
   25945 (NECTIN3)
CD molecules [BR:hsa04090]
 Proteins
  25945 (NECTIN3)
SSDB
Motif
Pfam: C2-set_2 Ig_3 V-set ig I-set Ig_2 Ig_6 C1-set Adeno_E3_CR2 Sarcoglycan_2
Other DBs
NCBI-GeneID: 25945
NCBI-ProteinID: NP_056295
OMIM: 607147
HGNC: 17664
Ensembl: ENSG00000177707
Vega: OTTHUMG00000159239
Pharos: Q9NQS3(Tbio)
UniProt: Q9NQS3
Structure
PDB: 
4FOM

Position
3q13.13
AA seq 549 aa
MARTLRPSPLCPGGGKAQLSSASLLGAGLLLQPPTPPPLLLLLFPLLLFSRLCGALAGPI
IVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGR
VLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDS
LIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSFPNETATIISQYKLFPTRFAR
GRRITCVVKHPALEKDIRYSFILDIQYAPEVSVTGYDGNWFVGRKGVNLKCNADANPPPF
KSVWSRLDGQWPDGLLASDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQKVIYISDPPT
TTTLQPTIQWHPSTADIEDLATEPKKLPFPLSTLATIKDDTIATIIASVVGGALFIVLVS
VLAGIFCYRRRRTFRGDYFAKNYIPPSDMQKESQIDVLQQDELDSYPDSVKKENKNPVNN
LIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKMGMKFVSDEHYDENEDDLVSHVDGS
VISRREWYV
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggcgcggaccctgcggccgtccccgctgtgtcctggaggcggcaaagcacaactttcc
tccgcttctctcctcggagccgggctcctgctgcagcccccgacgccacctccgctgctg
ctgctgctcttcccgctgctgctcttctccaggctctgtggtgccttagctggaccaatt
attgtggagccacatgtcacagcagtatggggaaagaatgtttcattaaagtgtttaatt
gaagtaaatgaaaccataacacagatttcatgggagaagatacatggcaaaagttcacag
actgttgcagttcaccatccccaatatggattctctgttcaaggagaatatcagggaaga
gtcttgtttaaaaattactcacttaatgatgcaacaattactctgcataacataggattc
tctgattctggaaaatacatctgcaaagctgttacattcccgcttggaaatgcccagtcc
tctacaactgtaactgtgttagttgaacccactgtgagcctgataaaagggccagattct
ttaattgatggaggaaatgaaacagtagcagccatttgcatcgcagccactggaaaaccc
gttgcacatattgactgggaaggtgatcttggtgaaatggaatccactacaacttctttt
ccaaatgaaacggcaacgattatcagccagtacaagctatttccaaccagatttgctaga
ggaaggcgaattacttgtgttgtaaaacatccagccttggaaaaggacatccgatactct
ttcatattagacatacagtatgctcctgaagtttcggtaacaggatatgatggaaattgg
tttgtaggaagaaaaggtgttaatctcaaatgtaatgctgatgcaaatccaccacccttc
aaatctgtgtggagcaggttggatggacaatggcctgatggtttattggcttcagacaat
actcttcattttgtccatccattgactttcaattattctggtgtttatatctgtaaagtg
accaattcccttggtcaaagaagtgaccaaaaagtcatctacatttcagatcctcctact
actaccacccttcagcctacaattcagtggcatccctcaactgctgacatcgaggatcta
gcaacagaacctaaaaaattgcccttcccattgtcaactttggcaacaattaaggatgac
acaattgccacgatcattgctagtgtagtgggtggggctctcttcatagtacttgtaagt
gttttggctggaatattctgctataggagaagacggacgtttcgtggagactactttgcc
aagaactacattccaccatcagatatgcaaaaagaatcacaaatagatgttcttcaacaa
gatgagcttgattcttacccagacagtgtaaaaaaagaaaacaaaaatccagtgaacaat
ctaatacgtaaagactatttagaagagcctgaaaaaactcagtggaacaatgtagaaaat
ctcaataggtttgaaagaccaatggattattatgaagatctaaaaatgggaatgaagttt
gtcagtgatgaacattatgatgaaaacgaagatgacttagtttcacatgtagatggttcc
gtaatttccaggagggagtggtatgtttag

DBGET integrated database retrieval system