KEGG   Homo sapiens (human): 25956Help
Entry
25956             CDS       T01001                                 

Gene name
SEC31B, SEC31B-1, SEC31L2
Definition
(RefSeq) SEC31 homolog B, COPII coat complex component
  KO
K14005  protein transport protein SEC31
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00404  COPII complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    25956 (SEC31B)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    25956 (SEC31B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec16_C ANAPC4_WD40 WD40 SRA1
Motif
Other DBs
NCBI-GeneID: 25956
NCBI-ProteinID: NP_056305
OMIM: 610258
HGNC: 23197
Ensembl: ENSG00000075826
Vega: OTTHUMG00000019342
Pharos: Q9NQW1(Tdark)
UniProt: Q9NQW1
Position
10q24.31
AA seq 1179 aa AA seqDB search
MKLKELERPAVQAWSPASQYPLYLATGTSAQQLDSSFSTNGTLEIFEVDFRDPSLDLKHR
GVLSALSRFHKLVWGSFGSGLLESSGVIVGGGDNGMLILYNVTHILSSGKEPVIAQKQKH
TGAVRALDLNPFQGNLLASGASDSEIFIWDLNNLNVPMTLGSKSQQPPEDIKALSWNRQA
QHILSSAHPSGKAVVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDIATQLVLCSEDDRLPV
IQLWDLRFASSPLKVLESHSRGILSVSWSQADAELLLTSAKDSQILCRNLGSSEVVYKLP
TQSSWCFDVQWCPRDPSVFSAASFNGWISLYSVMGRSWEVQHMRQADKISSSFSKGQPLP
PLQVPEQVAQAPLIPPLKKPPKWIRRPTGVSFAFGGKLVTFGLPSTPAHLVPQPCPRLVF
ISQVTTESEFLMRSAELQEALGSGNLLNYCQNKSQQALLQSEKMLWQFLKVTLEQDSRMK
FLKLLGYSKDELQKKVATWLKSDVGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASAS
SAFFDELVPQNMTPWEIPITKDIDGLLSQALLLGELGPAVELCLKEERFADAIILAQAGG
TDLLKQTQERYLAKKKTKISSLLACVVQKNWKDVVCTCSLKNWREALALLLTYSGTEKFP
ELCDMLGTRMEQEGSRALTSEARLCYVCSGSVERLVECWAKCHQALSPMALQDLMEKVMV
LNRSLEQLRGPHGVSPGPATTYRVTQYANLLAAQGSLATAMSFLPRDCAQPPVQQLRDRL
FHAQGSAVLGQQSPPFPFPRIVVGATLHSKETSSYRLGSQPSHQVPTPSPRPRVFTPQSS
PAMPLAPSHPSPYQGPRTQNISDYRAPGPQAIQPLPLSPGVRPASSQPQLLGGQRVQVPN
PVGFPGTWPLPGSPLPMACPGIMRPGSTSLPETPRLFPLLPLRPLGPGRMVSHTPAPPAS
FPVPYLPGDPGAPCSSVLPTTGILTPHPGPQDSWKEAPAPRGNLQRNKLPETFMPPAPIT
APVMSLTPELQGILPSQPPVSSVSHAPPGVPGELSLQLQHLPPEKMERKELPPEHQSLKS
SFEALLQRCSLSATDLKTKRKLEEAAQRLEYLYEKLCEGTLSPHVVAGLHEVARCVDAGS
FEQGLAVHAQVAGCSSFSEVSSFMPILKAVLIIAHKLLV
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaggaacttgagcggccagctgtccaggcatggagcccagccagccaatac
cctttgtatctggccacaggaacatctgcccaacagctagattcctccttcagcacaaat
ggcacattggaaatatttgaggttgatttcagggacccttctctggacttgaaacacaga
ggagtcctttctgccttgagcaggtttcacaagctggtctgggggagctttggcagtggg
cttctggaaagctccggggttattgttggcggcggggacaatggcatgcttattctatac
aatgtgacccacatcctgtcttcggggaaggagcctgtgattgctcagaaacagaagcac
acgggggctgtcagagccctcgacttgaatcctttccagggcaacctcctggcttcaggg
gccagcgattctgaaatcttcatttgggatctgaataacttgaatgtgccaatgaccctg
ggatccaagtcacagcagcctccagaggacatcaaggcactgtcttggaaccggcaagcc
caacacattctgtcttctgctcaccccagtggcaaggcagttgtgtgggatctcaggaag
aatgaacctatcatcaaagtcagtgatcacagcaacaggatgcactgctcaggcctggcc
tggcatcctgacatagccacccagttagtgctgtgctcagaggatgatcgacttcccgtg
attcagctgtgggacttgcgctttgcctcctcgcccttgaaggtgctggagagccacagc
agggggatcttgtcagtgtcatggagccaggctgatgctgagctgctgctcactagtgct
aaggacagccagatcttgtgccggaacctggggagcagtgaggtggtatataagctacca
acacagagcagctggtgctttgatgtgcagtggtgccctcgggacccttcagtgttctct
gctgcctccttcaacggctggatcagtttgtactctgtgatgggtaggagctgggaagtc
cagcatatgagacaggctgacaagatctcctcttccttcagcaaaggccagcctctccca
ccactgcaggtgccagagcaagtggcacaagcaccactgatacctcccctgaaaaaaccc
cccaaatggattagaagaccaacaggtgtttcatttgcttttggagggaagctggttact
tttggcctccccagcacccctgcccatctggtgccacagccttgcccccgcctagtcttc
atcagtcaagtcaccacagaatctgaattcctgatgcgatcagctgagctgcaggaggcc
ttgggatcaggaaatctactgaattactgtcagaacaagagccagcaagctttactgcaa
agtgaaaagatgctgtggcagttcctgaaggtgaccttagagcaagactccagaatgaaa
ttcctaaagcttttaggatacagtaaagatgagcttcagaagaaggtggccacatggttg
aagagtgacgtggggctaggtgagagtcctcagcccaagggaaatgacctcaacagtgac
agacaacaggccttctgcagccaggcctccaaacacaccacaaaggaagcctctgcttcc
tcagccttctttgatgagctggtccctcagaacatgactccttgggagatccccatcaca
aaagatattgatggactcctaagccaggctctcctgcttggggaactgggtccggccgtg
gagctgtgtctgaaggaggagcgctttgctgatgccattatcctggcccaggctgggggt
acagatctgctgaagcaaacacaggagcgctacttggccaagaagaaaaccaaaatctcc
tcgcttctagcctgtgttgtgcaaaagaattggaaggatgtggtgtgtacctgtagcctg
aagaactggagagaggcactggctttgctactgacatactcaggcacagagaaatttccc
gagctctgtgacatgctgggaactcgcatggaacaggagggcagcagggcactaacctcc
gaagccagactctgttatgtgtgctcagggagtgtggagcggctggtggagtgctgggca
aaatgccaccaggctttgtcccccatggctctgcaggacctgatggagaaggtgatggtt
cttaacaggagcttggagcaactgcggggtcctcatggggtgagcccaggccctgccaca
acctacagggtcactcagtatgccaacctcctggcagcccagggcagcctggccactgcc
atgagctttctacccagggactgtgctcagccaccagttcagcagctaagagatcggctt
tttcatgctcaaggttctgctgtcttgggccaacagtctccccctttccccttcccccgg
attgttgtgggagctaccctccactctaaagagacatcatcttacagattgggatcccag
ccttctcaccaggtcccaactccatctccaaggccaagggttttcacccctcagtcatca
ccagcgatgcccttggcaccttcccatcctagcccttatcagggtcccaggacacagaat
ataagtgactacagggcacctgggccccaggccatccagcctttgcctttgagccctggg
gtaaggcctgcttcatctcagccacagctattaggagggcaaagggtgcaagttcctaac
ccggtgggattccctgggacatggcctcttcctggttcccctctacccatggcatgccca
ggcatcatgcgacctggctctacctccctgcctgagactcctagactgttccctctgctt
cctctgagaccactaggtcccggccgcatggtctcccacaccccagcccctcctgcaagc
ttccctgtgccataccttccaggggacccaggtgccccatgctctagtgtcctcccaacc
actggcatcttgactcctcacccaggacctcaagattcctggaaagaagccccagccccc
aggggaaacctccagaggaacaagctgccagagacatttatgcccccagcaccaattact
gctccagttatgagcctcacccctgagctacaagggattcttccctcacagccccctgtc
tccagtgtgagtcatgctcccccaggagttccaggagaactcagcctgcagcttcagcac
ctgccacctgagaagatggaaaggaaggagctgcccccagagcatcagtccttgaagagc
agctttgaggcgcttctccaacgctgctccctgtctgcaactgacttaaagacaaaaagg
aagctggaagaggcagcccagcgtctggagtatctatatgagaagctctgtgaggggaca
ctctcacctcatgtcgtggctgggctccatgaggttgcccgatgtgtggatgcaggaagc
tttgagcagggccttgcagtgcatgcccaggtggcgggctgtagcagcttcagcgaggtg
tccagcttcatgcctatcctgaaggctgtcctcatcatcgctcataagctgctggtctaa

DBGET integrated database retrieval system