KEGG   Homo sapiens (human): 25959Help
Entry
25959             CDS       T01001                                 

Gene name
KANK2, ANKRD25, MXRA3, NPHS16, PPKWH, SIP
Definition
(RefSeq) KN motif and ankyrin repeat domains 2
  KO
K22808  KN motif and ankyrin repeat domain-containing protein
Organism
hsa  Homo sapiens (human)
Disease
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    25959 (KANK2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    25959 (KANK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 KN_motif Ank_3 Ank Ank_4 Ank_5
Motif
Other DBs
NCBI-GeneID: 25959
NCBI-ProteinID: NP_001129663
OMIM: 614610
HGNC: 29300
Ensembl: ENSG00000197256
Vega: OTTHUMG00000180799
Pharos: Q63ZY3(Tbio)
UniProt: Q63ZY3
Structure
PDB: 

Position
19p13.2
AA seq 851 aa AA seqDB search
MAQVLHVPAPFPGTPGPASPPAFPAKDPDPPYSVETPYGYRLDLDFLKYVDDIEKGHTLR
RVAVQRRPRLSSLPRGPGSWWTSTESLCSNASGDSRHSAYSYCGRGFYPQYGALETRGGF
NPRVERTLLDARRRLEDQAATPTGLGSLTPSAAGSTASLVGVGLPPPTPRSSGLSTPVPP
SAGHLAHVREQMAGALRKLRQLEEQVKLIPVLQVKLSVLQEEKRQLTVQLKSQKFLGHPT
AGRGRSELCLDLPDPPEDPVALETRSVGTWVRERDLGMPDGEAALAAKVAVLETQLKKAL
QELQAAQARQADPQPQAWPPPDSPVRVDTVRVVEGPREVEVVASTAAGAPAQRAQSLEPY
GTGLRALAMPGRPESPPVFRSQEVVETMCPVPAAATSNVHMVKKISITERSCDGAAGLPE
VPAESSSSPPGSEVASLTQPEKSTGRVPTQEPTHREPTRQAASQESEEAGGTGGPPAGVR
SIMKRKEEVADPTAHRRSLQFVGVNGGYESSSEDSSTAENISDNDSTENEAPEPRERVPS
VAEAPQLRPAGTAAAKTSRQECQLSRESQHIPTAEGASGSNTEEEIRMELSPDLISACLA
LEKYLDNPNALTERELKVAYTTVLQEWLRLACRSDAHPELVRRHLVTFRAMSARLLDYVV
NIADSNGNTALHYSVSHANFPVVQQLLDSGVCKVDKQNRAGYSPIMLTALATLKTQDDIE
TVLQLFRLGNINAKASQAGQTALMLAVSHGRVDVVKALLACEADVNVQDDDGSTALMCAC
EHGHKEIAGLLLAVPSCDISLTDRDGSTALMVALDAGQSEIASMLYSRMNIKCSFAPMSD
DESPTSSSAEE
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggtcctgcacgtgcctgctcccttcccagggacccctggcccagcctcccca
cctgccttccctgccaaggaccccgatccaccctactccgtggagaccccctatggctac
cgcctggacctggacttcctcaagtacgtggatgacatcgagaagggccacacgctgcga
cgcgtggcagtgcagcgccgcccccgcctgagctcgctgccccgtggccctggctcctgg
tggacgtccactgagtcgctgtgctccaatgccagtggggacagccgccactcagcctat
tcctactgcggccgtggcttctaccctcagtatggtgctctggagacccgcggtggcttc
aatccgcgggtggagcgcacgctgctggatgcccgtcgccgtctcgaggaccaggcggcc
acacccaccggcctgggctccctgacccccagtgcggccggctcgacagcctccctggtg
ggcgtggggttgccacccccgacaccacggagttcaggactgtccacaccggtgcctccc
agtgccgggcacctggcccacgtgcgggagcagatggcgggtgccctgcggaagctgcgg
cagctggaggagcaggtgaagctgatccctgtgctccaggtgaagctctcggtgctccag
gaggaaaagcggcagctcacagtacaacttaagagccagaagttcctgggccaccccaca
gcgggccggggtcgcagcgagctctgcctggacctccccgatcccccagaggacccagtg
gcactggagacccggagtgtgggcacctgggttcgagaacgggacttgggcatgcctgat
ggggaggctgccctcgccgccaaggtcgctgtgctggagacccagctcaagaaggcgctg
caggagctgcaggcagctcaggcccggcaggctgacccccagccccaggcctggccaccg
ccggacagcccggtccgcgtggatacagtccgggtggtagaagggccacgggaggtggag
gtggtggccagcacagccgctggcgcccccgcacagcgggcccagagcctggagccttac
ggcacagggctgagggccctggcaatgcctggtaggcctgagagcccacctgtgttccgc
agccaggaggtggtggagacaatgtgcccagtgcccgctgcagctaccagcaacgtccat
atggtgaagaagattagcatcacagagcgaagctgcgatggagcagcaggcctcccagaa
gttcctgccgaatcgtcttcgtcacccccggggtccgaggtagcctcccttacacagcct
gagaagagcacaggccgagtgcccacccaggagcccacccacagggagcccaccaggcaa
gcagcctcccaagagtccgaggaggccgggggcaccggcgggcccccggcaggcgtgcga
tctatcatgaaacggaaagaggaggttgcagaccccacggcccaccggaggagcctccag
ttcgtgggggtcaacggcgggtatgagtcgtcatccgaggactccagcacagcagagaac
atctcagacaacgacagcacagagaacgaggccccagagccgagggagagggttccgagt
gtggccgaagccccccagctcaggcctgcagggacggcagcggccaagaccagccggcag
gagtgtcagctgtctcgagaatctcagcacatacccactgctgagggggcatcaggatca
aacacggaggaggagatcaggatggagctaagccctgacctcatctcagcctgcttggcc
ctggaaaagtacctggacaatcccaacgccctcacagagcgggagctgaaagtggcctac
accacagtgctgcaggagtggctgcgcctggcctgccgcagcgacgcacaccccgagctg
gtgcggcggcacctggtcacgttccgggccatgtctgcgcggctgctggactacgtggtc
aacatcgccgacagcaacggcaacacagccctgcactactccgtgtctcatgccaacttc
cccgtggtgcagcagctgctcgacagcggtgtctgcaaggtggacaaacagaaccgtgct
ggctacagccctattatgctcaccgccctggccaccctgaagacccaggacgacatcgag
actgtccttcagctcttccggcttggcaacatcaatgccaaagccagccaggcaggacag
acggccctgatgctggccgtcagccacgggcgggtggacgttgtcaaagccctgctggcc
tgtgaggcagatgtcaacgtgcaagatgatgacggctccacggccctcatgtgcgcctgt
gagcacggccacaaggagatcgcggggctgctgctggccgtgcccagctgtgacatctca
ctcacagatcgcgatgggagcacagctctgatggtggccttggacgcagggcagagtgag
attgcgtccatgctgtattcccgcatgaacatcaagtgctcgtttgccccaatgtcagat
gacgagagccctacatcatcctcggcagaagagtag

DBGET integrated database retrieval system