KEGG   Homo sapiens (human): 2596Help
Entry
2596              CDS       T01001                                 

Gene name
GAP43, B-50, PP46
Definition
(RefSeq) growth associated protein 43
  KO
K20041  neuromodulin
Organism
hsa  Homo sapiens (human)
Brite
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Others
    2596 (GAP43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neuromodulin Neuromodulin_N IQ
Motif
Other DBs
NCBI-GeneID: 2596
NCBI-ProteinID: NP_002036
OMIM: 162060
HGNC: 4140
Ensembl: ENSG00000172020
Vega: OTTHUMG00000133758
Pharos: P17677(Tbio)
UniProt: P17677 Q5U058
Position
3q13.31
AA seq 238 aa AA seqDB search
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQ
AAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAAT
EQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAAT
TPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgctgtatgagaagaaccaaacaggttgaaaaaaatgatgacgaccaaaagatt
gaacaagatggtatcaaaccagaagataaagctcataaggccgcaaccaaaattcaggct
agcttccgtggacacataacaaggaaaaagctcaaaggagagaagaaggatgatgtccaa
gctgctgaggctgaagctaataagaaggatgaagcccctgttgccgatggggtggagaag
aagggagaaggcaccactactgccgaagcagccccagccactggctccaagcctgatgag
cccggcaaagcaggagaaactccttccgaggagaagaagggggagggtgatgctgccaca
gagcaggcagccccccaggctcctgcatcctcagaggagaaggccggctcagctgagaca
gaaagtgccactaaagcttccactgataactcgccgtcctccaaggctgaagatgcccca
gccaaggaggagcctaaacaagccgatgtgcctgctgctgtcactgctgctgctgccacc
acccctgccgcagaggatgctgctgccaaggcaacagcccagcctccaacggagactggg
gagagcagccaagctgaagagaacatagaagctgtagatgaaaccaaacctaaggaaagt
gcccggcaggacgagggtaaagaagaggaacctgaggctgaccaagaacatgcctga

DBGET integrated database retrieval system