KEGG   Homo sapiens (human): 25960Help
Entry
25960             CDS       T01001                                 

Gene name
ADGRA2, GPR124, TEM5
Definition
(RefSeq) adhesion G protein-coupled receptor A2
  KO
K08461  adhesion G protein-coupled receptor A2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    25960 (ADGRA2)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    25960 (ADGRA2)
Peptidases and inhibitors [BR:hsa01002]
 Mixed peptidases
  Family P2
   25960 (ADGRA2)
G protein-coupled receptors [BR:hsa04030]
 Adhesion receptor family
  Others
   25960 (ADGRA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 7tm_2 GPS LRR_1 HRM Ig_3 I-set ig
Motif
Other DBs
NCBI-GeneID: 25960
NCBI-ProteinID: NP_116166
OMIM: 606823
HGNC: 17849
Ensembl: ENSG00000020181
Vega: OTTHUMG00000156182
Pharos: Q96PE1(Tbio)
UniProt: Q96PE1 Q6YN44
Position
8p11.23
AA seq 1338 aa AA seqDB search
MGAGGRRMRGAPARLLLPLLPWLLLLLAPEARGAPGCPLSIRSCKCSGERPKGLSGGVPG
PARRRVVCSGGDLPEPPEPGLLPNGTVTLLLSNNKITGLRNGSFLGLSLLEKLDLRNNII
STVQPGAFLGLGELKRLDLSNNRIGCLTSETFQGLPRLLRLNISGNIFSSLQPGVFDELP
ALKVVDLGTEFLTCDCHLRWLLPWAQNRSLQLSEHTLCAYPSALHAQALGSLQEAQLCCE
GALELHTHHLIPSLRQVVFQGDRLPFQCSASYLGNDTRIRWYHNRAPVEGDEQAGILLAE
SLIHDCTFITSELTLSHIGVWASGEWECTVSMAQGNASKKVEIVVLETSASYCPAERVAN
NRGDFRWPRTLAGITAYQSCLQYPFTSVPLGGGAPGTRASRRCDRAGRWEPGDYSHCLYT
NDITRVLYTFVLMPINASNALTLAHQLRVYTAEAASFSDMMDVVYVAQMIQKFLGYVDQI
KELVEVMVDMASNLMLVDEHLLWLAQREDKACSRIVGALERIGGAALSPHAQHISVNARN
VALEAYLIKPHSYVGLTCTAFQRREGGVPGTRPGSPGQNPPPEPEPPADQQLRFRCTTGR
PNVSLSSFHIKNSVALASIQLPPSLFSSLPAALAPPVPPDCTLQLLVFRNGRLFHSHSNT
SRPGAAGPGKRRGVATPVIFAGTSGCGVGNLTEPVAVSLRHWAEGAEPVAAWWSQEGPGE
AGGWTSEGCQLRSSQPNVSALHCQHLGNVAVLMELSAFPREVGGAGAGLHPVVYPCTALL
LLCLFATIITYILNHSSIRVSRKGWHMLLNLCFHIAMTSAVFAGGITLTNYQMVCQAVGI
TLHYSSLSTLLWMGVKARVLHKELTWRAPPPQEGDPALPTPSPMLRFYLIAGGIPLIICG
ITAAVNIHNYRDHSPYCWLVWRPSLGAFYIPVALILLITWIYFLCAGLRLRGPLAQNPKA
GNSRASLEAGEELRGSTRLRGSGPLLSDSGSLLATGSARVGTPGPPEDGDSLYSPGVQLG
ALVTTHFLYLAMWACGALAVSQRWLPRVVCSCLYGVAASALGLFVFTHHCARRRDVRASW
RACCPPASPAAPHAPPRALPAAAEDGSPVFGEGPPSLKSSPSGSSGHPLALGPCKLTNLQ
LAQSQVCEAGAAAGGEGEPEPAGTRGNLAHRHPNNVHHGRRAHKSRAKGHRAGEACGKNR
LKALRGGAAGALELLSSESGSLHNSPTDSYLGSSRNSPGAGLQLEGEPMLTPSEGSDTSA
APLSEAGRAGQRRSASRDSLKGGGALEKESHRRSYPLNAASLNGAPKGGKYDDVTLMGAE
VASGGCMKTGLWKSETTV
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgggggacgcaggatgcggggggcgcccgcgcgcctgctgctgccgctgctg
ccgtggctcctgctgctcctggcgcccgaggctcggggcgcgcccggctgcccgctatcc
atccgcagctgcaagtgctcgggggagcggcccaaggggctgagcggcggcgtccctggc
ccggctcggcggagggtggtgtgcagcggcggggacctcccggagcctcccgagcccggc
cttctgcctaacggcaccgttaccctgctcttgagcaataacaagatcacggggctccgc
aatggctccttcctgggactgtcactgctggagaagctggacctgaggaacaacatcatc
agcacagtgcagccgggcgccttcctgggcctgggggagctgaagcgtttagatctctcc
aacaaccggattggctgtctcacctccgagaccttccagggcctccccaggcttctccga
ctaaacatatctggaaacatcttctccagtctgcaacctggggtctttgatgagctgcca
gcccttaaggttgtggacttgggcaccgagttcctgacctgtgactgccacctgcgctgg
ctgctgccctgggcccagaatcgctccctgcagctgtcggaacacacgctctgtgcttac
cccagtgccctgcatgctcaggccctgggcagcctccaggaggcccagctctgctgcgag
ggggccctggagctgcacacacaccacctcatcccgtccctacgccaagtggtgttccag
ggggatcggctgcccttccagtgctctgccagctacctgggcaacgacacccgcatccgc
tggtaccacaaccgagcccctgtggagggtgatgagcaggcgggcatcctcctggccgag
agcctcatccacgactgcaccttcatcaccagtgagctgacgctgtctcacatcggcgtg
tgggcctcaggcgagtgggagtgcaccgtgtccatggcccaaggcaacgccagcaagaag
gtggagatcgtggtgctggagacctctgcctcctactgccccgccgagcgtgttgccaac
aaccgcggggacttcaggtggccccgaactctggctggcatcacagcctaccagtcctgc
ctgcagtatcccttcacctcagtgcccctgggcgggggtgccccgggcacccgagcctcc
cgccggtgtgaccgtgccggccgctgggagccaggggactactcccactgtctctacacc
aacgacatcaccagggtgctgtacaccttcgtgctgatgcccatcaatgcctccaatgcg
ctgaccctggctcaccagctgcgcgtgtacacagccgaggccgctagcttttcagacatg
atggatgtagtctatgtggctcagatgatccagaaatttttgggttatgtcgaccagatc
aaagagctggtagaggtgatggtggacatggccagcaacctgatgctggtggacgagcac
ctgctgtggctggcccagcgcgaggacaaggcctgcagccgcatcgtgggtgccctggag
cgcattgggggggccgccctcagcccccatgcccagcacatctcagtgaatgcgaggaac
gtggcattggaggcctacctcatcaagccgcacagctacgtgggcctgacctgcacagcc
ttccagaggagggagggaggggtgccgggcacacggccaggaagccctggccagaacccc
ccacctgagcccgagcccccagctgaccagcagctccgcttccgctgcaccaccgggagg
cccaatgtttctctgtcgtccttccacatcaagaacagcgtggccctggcctccatccag
ctgcccccgagtctattctcatcccttccggctgccctggctcccccggtgcccccagac
tgcaccctgcaactgctcgtcttccgaaatggccgcctcttccacagccacagcaacacc
tcccgccctggagctgctgggcctggcaagaggcgtggcgtggccacccccgtcatcttc
gcaggaaccagtggctgtggcgtgggaaacctgacagagccagtggccgtttcgctgcgg
cactgggctgagggagccgaacctgtggccgcttggtggagccaggaggggcccggggag
gctgggggctggacctcggagggctgccagctccgctccagccagcccaatgtcagcgcc
ctgcactgccagcacttgggcaatgtggccgtgctcatggagctgagcgcctttcccagg
gaggtggggggcgccggggcagggctgcaccccgtggtatacccctgcacggccttgctg
ctgctctgcctcttcgccaccatcatcacctacatcctcaaccacagctccatccgtgtg
tcccggaaaggctggcacatgctgctgaacttgtgcttccacatagccatgacctctgct
gtctttgcggggggcatcacactcaccaactaccagatggtctgccaggcggtgggcatc
accctgcactactcctccctatccacgctgctctggatgggcgtgaaggcgcgagtgctc
cataaggagctcacctggagggcaccccctccgcaagaaggggaccccgctctgcctact
cccagtcctatgctccggttctatttgatcgctggagggattccactcattatctgtggc
atcacagctgcagtcaacatccacaactaccgggaccacagcccctactgctggctggtg
tggcgtccaagccttggcgccttctacatccctgtggctttgattctgctcatcacctgg
atctatttcctgtgcgccgggctacgcttacggggtcctctggcacagaaccccaaggcg
ggcaacagcagggcctccctggaggcaggggaggagctgaggggttccaccaggctcagg
ggcagcggccccctcctgagtgactcaggttcccttcttgctactgggagcgcgcgagtg
gggacgcccgggcccccggaggatggtgacagcctctattctccgggagtccagctaggg
gcgctggtgaccacgcacttcctgtacttggccatgtgggcctgcggggctctggcagtg
tcccagcgctggctgccccgggtggtgtgcagctgcttgtacggggtggcagcctccgcc
ctgggcctcttcgtcttcactcaccactgtgccaggcggagggacgtgagagcctcgtgg
cgcgcctgctgcccccctgcctctcccgcggccccccatgccccgccccgggccctgccc
gccgccgcagaggacggttccccggtgttcggggagggccccccctccctcaagtcctcc
ccaagcggcagcagcggccatccgctggctctgggcccctgcaagctcaccaacctgcag
ctggcccagagtcaggtgtgcgaggcgggggcggcggccggcggggaaggagagccggag
ccggcgggcacccggggaaacctcgcccaccgccaccccaacaacgtgcaccacgggcgt
cgggcgcacaagagccgggccaagggacaccgcgcgggggaggcctgcggcaagaaccgg
ctcaaggccctgcgcgggggcgcggcgggggcgctggagctgctgtccagcgagagcggc
agtctgcacaacagccccaccgacagctacctgggcagcagccgcaacagcccgggcgcc
ggcctgcagctggaaggcgagcccatgctcacgccgtccgagggcagcgacaccagcgcc
gcgccgctttctgaggcgggccgggcaggccagcgccgcagcgccagccgcgacagtctc
aagggcggcggcgcgctggagaaggagagccatcgccgctcgtacccgctcaacgccgcc
agcctaaacggcgcccccaaggggggcaagtacgacgacgtcaccctgatgggcgcggag
gtagccagcggcggctgcatgaagaccggactctggaagagcgaaactaccgtctaa

DBGET integrated database retrieval system