KEGG   Homo sapiens (human): 25961
Entry
25961             CDS       T01001                                 
Symbol
NUDT13
Name
(RefSeq) nudix hydrolase 13
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    25961 (NUDT13)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    25961 (NUDT13)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     25961 (NUDT13)
SSDB
Motif
Pfam: NUDIX NUDIX-like zf-NADH-PPase
Other DBs
NCBI-GeneID: 25961
NCBI-ProteinID: NP_056985
OMIM: 609233
HGNC: 18827
Ensembl: ENSG00000166321
UniProt: Q86X67
Position
10:73110455..73131823
AA seq 352 aa
MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFYLFHSLAPLLQ
TSAHQYLAPRHSLLELERLLGKFGQDAQRIEDSVLIGCSEQQEAWFALDLGLDSSFSISA
SLHKPEMETELKGSFIELRKALFQLNARDASLLSTAQALLRWHDAHQFCSRSGQPTKKNV
AGSKRVCPSNNIIYYPQMAPVAITLVSDGTRCLLARQSSFPKGMYSALAGFCDIGESVEE
TIRREVAEEVGLEVESLQYYASQHWPFPSGSLMIACHATVKPGQTEIQVNLRELETAAWF
SHDEVATALKRKGPYTQQQNGTFPFWLPPKLAISHQLIKEWVEKQTCSSLPA
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgtccctgtattgtggaatagcttgcaggagaaaatttttttggtgctataggctgctg
tcaacctatgttactaagacacggtatttatttgaactgaaggaagatgatgatgcatgt
aaaaaagcccagcaaacaggagcgttttacctctttcatagtctggctcctctgcttcag
acttcagcacatcaatacctggccccccggcacagcctgttagagttggaaaggctcctg
ggtaaatttggacaggatgcacaaagaatagaagattctgtgctgattggatgctctgag
cagcaggaagcatggtttgctctggatctaggtctggatagctccttttccataagtgcc
tccttacacaaacctgaaatggagacagagctcaaggggtctttcattgagctgagaaag
gcactctttcaactcaatgcaagggatgcctccttgctgtccacggctcaagctcttctc
cgctggcatgatgctcatcagttctgcagcagaagtgggcagcccaccaagaagaacgtg
gctggcagcaagcgtgtgtgcccttccaataatataatctattatccacagatggctcct
gtggcgatcacgctggtgtcagatgggacccgatgcctgcttgcccgccaaagctccttt
cccaagggaatgtattctgccttggcaggtttttgtgatataggtgaaagtgtggaagag
accatccgccgagaagttgcagaagaggtgggattggaggtggaaagcctgcagtactat
gcatcccagcattggcccttccctagtggctcactcatgattgcttgccatgcaactgtg
aaaccagggcagacagaaatccaggtgaacttgagagaattagagacagctgcctggttc
agtcatgatgaggtagccacagccctgaagagaaagggcccctatactcagcaacagaat
gggactttcccattctggctgccccctaagttagccatctcccaccaactgattaaggag
tgggtggaaaaacagacctgttcttccctgcctgcttag

DBGET integrated database retrieval system