KEGG   Homo sapiens (human): 25963Help
Entry
25963             CDS       T01001                                 

Gene name
TMEM87A
Definition
(RefSeq) transmembrane protein 87A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Lung_7-TM_R SPT6_acidic
Motif
Other DBs
NCBI-GeneID: 25963
NCBI-ProteinID: NP_056312
HGNC: 24522
Ensembl: ENSG00000103978
Vega: OTTHUMG00000172783
Pharos: Q8NBN3(Tdark)
UniProt: Q8NBN3
Position
15q15.1
AA seq 555 aa AA seqDB search
MAAAAWLQVLPVILLLLGAHPSPLSFFSAGPATVAAADRSKWHIPIPSGKNYFSFGKILF
RNTTIFLKFDGEPCDLSLNITWYLKSADCYNEIYNFKAEEVELYLEKLKEKRGLSGKYQT
SSKLFQNCSELFKTQTFSGDFMHRLPLLGEKQEAKENGTNLTFIGDKTAMHEPLQTWQDA
PYIFIVHIGISSSKESSKENSLSNLFTMTVEVKGPYEYLTLEDYPLMIFFMVMCIVYVLF
GVLWLAWSACYWRDLLRIQFWIGAVIFLGMLEKAVFYAEFQNIRYKGESVQGALILAELL
SAVKRSLARTLVIIVSLGYGIVKPRLGVTLHKVVVAGALYLLFSGMEGVLRVTGAQTDLA
SLAFIPLAFLDTALCWWIFISLTQTMKLLKLRRNIVKLSLYRHFTNTLILAVAASIVFII
WTTMKFRIVTCQSDWRELWVDDAIWRLLFSMILFVIMVLWRPSANNQRFAFSPLSEEEEE
DEQKEPMLKESFEGMKMRSTKQEPNGNSKVNKAQEDDLKWVEENVPSSVTDVALPALLDS
DEERMITHFERSKME
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgcgtggcttcaggtgttgcctgtcattcttctgcttctgggagctcac
ccgtcaccactgtcgtttttcagtgcgggaccggcaaccgtagctgctgccgaccggtcc
aaatggcacattccgataccgtcggggaaaaattattttagttttggaaagatcctcttc
agaaataccactatcttcctgaagtttgatggagaaccttgtgacctgtctttgaatata
acctggtatctgaaaagcgctgattgttacaatgaaatctataacttcaaggcagaagaa
gtagagttgtatttggaaaaacttaaggaaaaaagaggcttgtctgggaaatatcaaaca
tcatcaaaattgttccagaactgcagtgaactctttaaaacacagaccttttctggagat
tttatgcatcgactgcctcttttaggagaaaaacaggaggctaaggagaatggaacaaac
cttacctttattggagacaaaaccgcaatgcatgaaccattgcaaacttggcaagatgca
ccatacatttttattgtacatattggcatttcatcctcaaaggaatcatcaaaagaaaat
tcactgagtaatctttttaccatgactgttgaagtgaagggtccctatgaatacctcaca
cttgaagactatcccttgatgatttttttcatggtgatgtgtattgtatatgtcctgttt
ggtgttctgtggctggcatggtctgcctgctactggagagatctcctgagaattcagttt
tggattggtgctgtcatcttcctgggaatgcttgagaaagctgtcttctatgcggaattt
cagaatatccgatacaaaggagaatctgtccagggtgctttgatccttgcagagctgctt
tcagcagtgaaacgctcactggctcgaaccctggtcatcatagtcagtctgggatatggc
atcgtcaagccacgccttggagtcactcttcataaggttgtagtagcaggagccctctat
cttttgttctctggcatggaaggggtcctcagagttactggggcccagactgatcttgct
tccttggcctttatccccttggctttcctagacactgccttgtgctggtggatatttatt
agcctgactcaaacaatgaagctattaaaacttcggaggaacattgtaaaactctctttg
tatcggcatttcaccaacacgcttattttggcagtggcagcatccattgtgtttatcatc
tggacaaccatgaagttcagaatagtgacatgtcagtcggactggcgggagctgtgggta
gacgatgccatctggcgcttgctgttctccatgatcctctttgtcatcatggttctctgg
cgaccatctgcaaacaaccagaggtttgccttttcaccattgtctgaggaagaggaggag
gatgaacaaaaggagcctatgctgaaagaaagctttgaaggaatgaaaatgagaagtacc
aaacaagaacccaatggaaatagtaaagttaacaaagcacaggaagatgatttgaagtgg
gtagaagagaatgttccttcttctgtgacagatgtagcacttccagcccttctggattca
gatgaggaacgaatgatcacacactttgaaaggtccaaaatggagtaa

DBGET integrated database retrieval system