KEGG   Homo sapiens (human): 25966
Entry
25966             CDS       T01001                                 
Symbol
C2CD2, C21orf25, C21orf258, TMEM24L
Name
(RefSeq) C2 calcium dependent domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SMP_C2CD2L C2
Other DBs
NCBI-GeneID: 25966
NCBI-ProteinID: NP_056315
OMIM: 617581
HGNC: 1266
Ensembl: ENSG00000157617
Pharos: Q9Y426(Tdark)
UniProt: Q9Y426
Position
21:complement(41885112..41954018)
AA seq 696 aa
MAMARLGSWLGEAQWLALVSLFVAALATVGLYLAQWALARARPQPQRRAVEPGEGPRPGS
DALLSWILTLGSWRSQWQAAWVTALNEEAERKGGPPFLSFEEDPRQQALELVVQEVSSVL
RSAEEKVVVCHVVGQAIQFLVSETPALGAGCRLYDMRLSPFHLQLEFHMKEKREDLQISW
SFISVPEMAVNIQPKALGEDQVAETSAMSDVLKDILKHLAGSASPSVVLITKPTTVKEAQ
NLQCAASTAQESCPPKPPRAHELKLLVRNIHVLLLSEPGASGHINAVCVVQLNDPVQRFS
STLTKNTPDLMWEEEFTFELNAKSKELHLQISEAGRSSEGLLATATVPLDLFKKQPSGPQ
SFTLTSGSACGSSVLGSVTAEFSYMEPGELKSWPIPPPVPAAKIEKDRTVMPCGTVVTTV
TAVKTKPRVDVGRASPLSSDSPVKTPIKVKVIEKDISVQAIACRSAPVSKTLSSSDTELL
VLNGSDPVAEVAIRQLSESSKLKLKSPRKKSTIIISGISKTSLSQDHDAALMQGYTASVD
STHQEDAPSHPERAAASAPPEEAESAQASLAPKPQEDELDSWDLEKEPQAAAWSSQVLLD
PDGDELSESSMSVLEPGTAKKHKGGILRKGAKLFFRRRHQQKDPGMSQSHNDLVFLEQPE
GSRRKGITLTRILNKKLLSRHRNKNTMNGAPVEPCT
NT seq 2091 nt   +upstreamnt  +downstreamnt
atggccatggcccggctgggctcgtggctcggggaggcgcagtggctcgcgctggtgtcg
ctcttcgtcgcggccctggccacggtaggcctgtacctggcgcagtgggcgctggccagg
gcgcgaccccagccccagcggcgggcggtggagcctggagaggggccgcgcccggggtcc
gacgcgctgctctcctggatcctgacgctgggcagctggaggagccagtggcaggcggcc
tgggtgaccgccctgaacgaggaggccgagaggaaagggggcccacctttcctgtccttt
gaggaggacccgcggcagcaggcactggagctggtggtgcaggaggtctccagcgtgctc
aggtcggcggaggagaaggtggtggtctgtcacgtggtgggccaggctattcagttcttg
gtcagcgagacgcctgccttgggtgctggatgccggctgtacgacatgcggctctcccct
ttccatttacagctggagttccacatgaaggagaagagagaggacctccagattagctgg
tctttcatcagtgtgccggaaatggccgttaatatccagcccaaagcactgggggaggac
caggtggctgagacaagtgcgatgtctgacgttctcaaggacatcttgaagcatttggct
ggttctgcctctccatcagtggttctgattaccaagcccacgactgtaaaggaagctcag
aacttacagtgtgctgcatctactgctcaggaatcctgtcctcctaaacctccaagggct
cacgagctgaagctactggtgaggaacatccacgtcttgctgctcagcgagcccggtgcc
tcaggccacattaatgcagtgtgcgtcgtgcagctgaacgatcctgttcagaggttctcc
agcaccctgacgaaaaacactccggacctcatgtgggaagaggaattcaccttcgagttg
aatgccaagtcgaaggagttacacctgcagatttcagaggctgggcgatcctcagaaggt
ctgctggcgacggcgacagttcctctggacttatttaagaagcagccttctgggccacag
agcttcacgctgaccagcgggtctgcctgcggcagctcggtgctgggctcggtcacggca
gagttctcttacatggaacctggtgaattgaaatcctggcccatccctccccctgttcct
gctgcaaaaatagaaaaggaccgcacggtgatgccctgtgggactgtggtcactactgtc
actgctgtgaagaccaagcctcgcgtcgacgtggggagggcgtccccgctgagctctgat
tctccggtgaagactcccatcaaggtgaaggtgatcgagaaggacatctctgtccaggcc
atcgcctgccgcagcgcccccgtcagcaaaacactctcttcttcagacacagaattgttg
gtgttgaatggttcggatccagtggctgaagtggccattcgacagctcagtgaatcttca
aagctgaaactcaagtcgccacggaagaaaagcactattatcatatcagggatctccaag
acctcactatctcaggaccacgacgctgccctgatgcagggctacacggcctctgtggac
agcacccaccaggaggacgccccatcccatccggagagggcggcagcctctgccccgcca
gaggaagccgagtcagcccaggcatcccttgcccccaagccccaggaggacgagctagac
tcctgggacttggagaaggagccacaggccgcggcatggagcagccaggtcctgctggac
cccgacggtgatgagctgtcagagagctccatgagtgtcttggagccgggcactgccaaa
aagcataaaggaggaattctaaggaaaggtgcaaagctgttcttccgccggcggcatcaa
cagaaagacccaggcatgagtcagtcacacaatgaccttgtgttcctggagcagccagag
ggttcccggaggaaaggcatcaccctcaccaggatcctgaacaagaagctgctctccagg
cacagaaacaagaacaccatgaacggtgcccccgtggagccctgcacgtag

DBGET integrated database retrieval system