KEGG   Homo sapiens (human): 25976
Entry
25976             CDS       T01001                                 
Symbol
TIPARP, ARTD14, PARP7, pART14
Name
(RefSeq) TCDD inducible poly(ADP-ribose) polymerase
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Drug target
Atamparib: D12408
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    25976 (TIPARP)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     25976 (TIPARP)
SSDB
Motif
Pfam: PARP WWE zf-CCCH Torus
Other DBs
NCBI-GeneID: 25976
NCBI-ProteinID: NP_001171646
OMIM: 612480
HGNC: 23696
Ensembl: ENSG00000163659
Position
3:156674590..156706770
AA seq 657 aa
MEMETTEPEPDCVVQPPSPPDDFSCQMRLSEKITPLKTCFKKKDQKRLGTGTLRSLRPIL
NTLLESGSLDGVFRSRNQSTDENSLHEPMMKKAMEINSSCPPAENNMSVLIPDRTNVGDQ
IPEAHPSTEAPERVVPIQDHSFPSETLSGTVADSTPAHFQTDLLHPVSSDVPTSPDCLDK
VIDYVPGIFQENSFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQENGI
EICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQSVFNDSQEHLERFYCNPENDR
MRMKYGGQEFWADLNAMNVYETTEFDQLRRLSTPPSSNVNSIYHTVWKFFCRDHFGWREY
PESVIRLIEEANSRGLKEVRFMMWNNHYILHNSFFRREIKRRPLFRSCFILLPYLQTLGG
VPTQAPPPLEATSSSQIICPDGVTSANFYPETWVYMHPSQDFIQVPVSAEDKSYRIIYNL
FHKTVPEFKYRILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQDVVD
GICKHNFDPRVCGKHATMFGQGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRYTMGS
HGMRRPPPVNPGSVTSDLYDSCVDNFFEPQIFVIFNDDQSYPYFVIQYEEVSNTVSI
NT seq 1974 nt   +upstreamnt  +downstreamnt
atggaaatggaaaccaccgaacctgagccagactgtgtagtgcagcctccctctcctcct
gatgacttttcatgccaaatgagactctctgagaagatcactccattgaagacttgtttt
aagaaaaaggatcagaaaagattgggaactggaaccctgaggtctttgaggccaatatta
aacactcttctagaatctggctcacttgatggggtttttagatctaggaaccagagtaca
gatgagaacagcttacatgaacctatgatgaagaaagccatggaaatcaattcatcatgc
ccaccagcagaaaataatatgtctgttctgattcctgataggacaaatgttggggaccag
ataccggaagcccatccttccactgaagctccagaacgagtggttccaatccaagatcac
agctttccatcagaaaccctcagtgggacggtggcagattccacaccagctcacttccag
actgatcttttgcacccagtttcaagtgatgttcctactagtcctgactgcttagacaaa
gtcatagattatgttccaggcattttccaagaaaacagttttacaatccaatacattctg
gacaccagtgataagctgagtactgagctctttcaggacaaaagtgaagaggcttccctt
gacctcgtgtttgagctggtgaaccagttgcagtaccacactcaccaagagaacggaatt
gaaatttgcatggactttctgcaaggcacttgtatttatggcagggattgtttgaagcac
cacactgtcttgccatatcattggcagatcaaaaggacaactactcaaaagtggcagagt
gtattcaatgattctcaggagcacttggaaagattttactgtaacccagaaaatgataga
atgagaatgaagtatggaggacaagaattttgggcagatttgaatgccatgaacgtgtat
gaaacaactgaatttgaccaactacgaaggctgtccacaccaccctctagcaatgtcaac
tctatttaccacacagtctggaaattcttctgtagggaccactttggatggagagagtat
cccgagtctgtcattcgattgattgaagaagccaactctcggggtctgaaagaggttcga
tttatgatgtggaataaccactacatcctccacaattcattcttcaggagagagataaaa
aggagacccctcttccgctcctgttttatactgcttccatatttacagacacttggtggg
gttcccacacaagctcctccacctcttgaagcaacttcatcatcacaaattatctgccca
gatggggtcacttcagcaaacttttaccctgaaacttgggtttatatgcatccatctcag
gacttcatccaagtccctgtttctgcagaggataaaagttatcggatcatttacaatctt
tttcataagactgtgcctgagtttaaatacagaattttgcagatattgagagtccaaaac
cagtttctttgggagaaatataaaaggaaaaaggaatatatgaacaggaaaatgtttggc
cgtgacaggataataaatgagagacatttatttcatggaacatcccaggatgtggtagat
ggaatctgcaaacacaactttgaccctcgagtctgtggaaagcatgctacaatgtttgga
caaggcagttattttgcaaagaaggcaagctactctcataacttttctaagaagtcctcc
aaaggagtccacttcatgtttctggccaaagtgctgacgggcagatacacaatgggcagt
catggcatgagaaggcccccgccagtcaatcctggcagtgtcaccagtgacctttatgac
tcttgtgtggataatttctttgagcctcagatttttgtcatttttaatgatgaccagagt
tacccttattttgttatccaatatgaagaagtcagtaacactgtttccatttga

DBGET integrated database retrieval system