KEGG   Homo sapiens (human): 26007Help
Entry
26007             CDS       T01001                                 

Gene name
TKFC, DAK, NET45
Definition
(RefSeq) triokinase and FMN cyclase
  KO
K00863  triose/dihydroxyacetone kinase / FAD-AMP lyase (cyclizing) [EC:2.7.1.28 2.7.1.29 4.6.1.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    26007 (TKFC)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    26007 (TKFC)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    26007 (TKFC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.28  triokinase
     26007 (TKFC)
    2.7.1.29  glycerone kinase
     26007 (TKFC)
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.15  FAD-AMP lyase (cyclizing)
     26007 (TKFC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dak1 Dak2
Motif
Other DBs
NCBI-GeneID: 26007
NCBI-ProteinID: NP_056348
OMIM: 615844
HGNC: 24552
Ensembl: ENSG00000149476
Vega: OTTHUMG00000168076
Pharos: Q3LXA3(Tbio)
UniProt: Q3LXA3 A0A140VJH7
Position
11q12.2
AA seq 575 aa AA seqDB search
MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHE
PAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGL
AREQARAEGIPVEMVVIGDDSAFTVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEIAKQ
VNVVAKAMGTLGVSLSSCSVPGSKPTFELSADEVELGLGIHGEAGVRRIKMATADEIVKL
MLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGRGVKIARALV
GTFMSALEMPGISLTLLLVDEPLLKLIDAETTAAAWPNVAAVSITGRKRSRVAPAEPQEA
PDSTAAGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEWLK
EGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLE
AMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAG
AGRASYISSARLEQPDPGAVAAAAILRAILEVLQS
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaagaagctggtgaactcggtggctggctgtgctgatgacgctcttgctggc
ctggtggcctgcaaccccaacctgcagctcctgcagggccaccgcgtggccctccgttct
gacctggacagcctcaagggccgggtggcactgctgtcgggtgggggctctggccatgag
cctgcccatgctggtttcatagggaaggggatgctgactggggtcatcgcgggagctgtg
ttcacctccccggcagtgggcagcatcctggcagccatcagggccgtggcccaggccggc
acagtggggacgctccttatcgtgaagaactacactggggatcggctcaacttcggcctg
gcccgggagcaggcccgggctgaaggcatcccggtggagatggtggtgattggggacgac
agcgccttcactgtcctgaagaaggcaggccggcgggggctgtgcggcacggtgcttata
cacaaggtggcaggtgctctggctgaggctggtgtggggctggaggagatcgcaaagcag
gtgaacgtggtcgccaaggccatgggtaccctgggggtgagcttatcctcctgcagcgtc
cctggttccaaacccaccttcgagctctcagccgacgaggtggagctgggcctggggatc
cacggggaagctggtgtgcgccggataaagatggcaaccgccgatgagattgtgaaactc
atgctcgaccacatgacaaacaccaccaacgcgtcccatgtgcctgtgcagcccggctcc
tcagttgtgatgatggtcaacaacctgggtggcctgtcattcctggaactgggcatcata
gccgacgctaccgtccgctccctggagggccgcggggtgaagattgcccgtgccctggtg
ggcaccttcatgtcagcactggagatgcctggcatttctctcaccctcctgctggtggat
gagcctctcctgaaactgatagatgctgaaaccactgcagcagcctggcctaacgtggct
gcagtctccattactgggcggaagcggagccgggtagcccctgccgagccccaggaggcc
cctgattccactgctgcaggaggctcagcctcgaagcggatggcgctggtgctggaacgg
gtgtgcagcactctcctgggcctggaggaacacctgaatgccctggaccgggctgctggt
gacggcgactgtggcaccacccacagccgtgcggccagagcaatccaggagtggctgaag
gagggcccaccccctgccagccctgcccagctgctctccaagttgtctgtcctgctcctg
gagaagatgggaggctcatctggggcgctctatggcctgttcctgactgcggctgcacag
cccctgaaggccaagaccagcctcccagcctggtctgctgccatggatgccggcctggaa
gccatgcagaagtatggcaaggctgctccaggggacaggactatgctggattctctgtgg
gcagcggggcaggagctccaagcctggaagagcccaggagctgatctgttacaagtcctg
accaaagcagtcaagagtgccgaagctgcagccgaggccaccaagaatatggaagctgga
gccggaagagccagttatatcagctcagcacggctggagcagccagaccccggggcggtg
gcagctgctgccatcctccgggccatcttggaggtcttgcagagctag

DBGET integrated database retrieval system