KEGG   Homo sapiens (human): 26009
Entry
26009             CDS       T01001                                 

Gene name
ZZZ3, ATAC1
Definition
(RefSeq) zinc finger ZZ-type containing 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Myb_DNA-binding ZZ Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 26009
NCBI-ProteinID: NP_056349
HGNC: 24523
Ensembl: ENSG00000036549
Vega: OTTHUMG00000009652
Pharos: Q8IYH5(Tdark)
UniProt: Q8IYH5
Structure
PDB: 
6E83 6E86 2YUM 2FC7

Position
1p31.1
AA seq 903 aa
MAASRSTRVTRSTVGLNGLDESFCGRTLRNRSIAHPEEISSNSQVRSRSPKKRPEPVPIQ
KGNNNGRTTDLKQQSTRESWVSPRKRGLSSSEKDNIERQAIENCERRQTEPVSPVLKRIK
RCLRSEAPNSSEEDSPIKSDKESVEQRSTVVDNDADFQGTKRACRCLILDDCEKREIKKV
NVSEEGPLNSAVVEEITGYLAVNGVDDSDSAVINCDDCQPDGNTKQNSIGSYVLQEKSVA
ENGDTDTQTSMFLDSRKEDSYIDHKVPCTDSQVQVKLEDHKIVTACLPVEHVNQLTTEPA
TGPFSETQSSLRDSEEEVDVVGDSSASKEQCKENTNNELDTSLESMPASGEPEPSPVLDC
VSAQMMSLSEPQEHRYTLRTSPRRAAPTRGSPTKNSSPYRENGQFEENNLSPNETNATVS
DNVSQSPTNPGEISQNEKGICCDSQNNGSEGVSKPPSEARLNIGHLPSAKESASQHITEE
EDDDPDVYYFESDHVALKHNKDYQRLLQTIAVLEAQRSQAVQDLESLGRHQREALKNPIG
FVEKLQKKADIGLPYPQRVVQLPEIVWDQYTHSLGNFEREFKNRKRHTRRVKLVFDKVGL
PARPKSPLDPKKDGESLSYSMLPLSDGPEGSSSRPQMIRGRLCDDTKPETFNQLWTVEEQ
KKLEQLLIKYPPEEVESRRWQKIADELGNRTAKQVASRVQKYFIKLTKAGIPVPGRTPNL
YIYSKKSSTSRRQHPLNKHLFKPSTFMTSHEPPVYMDEDDDRSCFHSHMNTAVEDASDDE
SIPIMYRNLPEYKELLQFKKLKKQKLQQMQAESGFVQHVGFKCDNCGIEPIQGVRWHCQD
CPPEMSLDFCDSCSDCLHETDIHKEDHQLEPIYRSETFLDRDYCVSQGTSYNYLDPNYFP
ANR
NT seq 2712 nt   +upstreamnt  +downstreamnt
atggctgcttcccgatctactcgtgttacaagatcaacagtggggttaaacggcttggat
gaatctttttgtggtagaactttaaggaatcgtagcattgcgcatcctgaagaaatctct
tctaattctcaagtacgatcaagatcaccaaagaagagaccagagcctgtgccaattcag
aaaggaaataataatgggagaaccactgatttaaaacagcagagtacccgagaatcatgg
gtaagccctaggaaaagaggactttcttcttcagaaaaggataacatagaaaggcaggct
atagaaaattgtgagagaaggcaaacagaacctgtttcaccagttttaaaaagaattaag
cgttgtcttagatctgaagcaccaaacagttcagaagaagattctcctataaaatcagac
aaggagtcagtagaacagaggagtacagtagtggacaatgatgcagattttcaagggact
aaacgagcttgtcgatgtcttatactggatgattgtgagaaaagggaaattaaaaaggtg
aatgtcagtgaggaagggccacttaattctgcagtagttgaagaaatcacaggctatttg
gctgtcaatggtgttgatgacagtgattcagctgttataaactgtgatgactgtcagcct
gatgggaacactaaacaaaatagcattggttcctatgtgttacaggaaaaatcagtagct
gaaaatggggatacggatacccaaacttcaatgttccttgatagtaggaaggaggacagt
tatatagaccataaggtgccttgcacagattcacaagtgcaggtcaagttggaggaccac
aaaatagtaactgcctgcttgcctgtggaacatgttaatcagctgactactgagccagct
acagggcccttttctgaaactcagtcatctttaagggattctgaggaggaagtagatgtg
gtgggagatagcagtgcctcaaaagagcagtgtaaagaaaacaccaataacgaactggac
acaagtcttgagagtatgccagcctccggagaacctgaaccatctcctgttctagactgt
gtttcagctcaaatgatgtctttatcagaacctcaagaacatcgttatactctgagaacc
tcaccacgaagggcagcccctaccagaggtagtcccactaaaaacagttctccttacaga
gaaaatggacaatttgaggagaataatcttagtcctaatgaaacaaatgcaactgttagt
gataatgtaagtcaatctcctacaaatcctggtgaaatttctcaaaatgaaaaagggata
tgttgtgactctcaaaataatggaagtgaaggagtaagtaaaccaccctcagaggcaaga
ctcaatattggacatttgccatctgccaaagagagtgccagtcagcacattacagaagag
gaagatgatgatcctgatgtttattactttgaatcagatcatgtggcactgaaacacaac
aaagattatcagagactattacagacgattgctgtactcgaggctcagcgttctcaagca
gtccaagaccttgaaagtttaggcaggcaccagagagaagcactgaaaaatcccattgga
tttgtggaaaaactccagaagaaggctgatattgggcttccatatccacagagagttgtt
caattgcctgagatcgtatgggaccaatatacccatagccttgggaattttgaaagagaa
tttaaaaatcgtaaaagacatactagaagagttaagctagtttttgataaagtaggttta
cctgctagaccaaaaagtcctttagatcctaagaaggatggagagtccctttcatattct
atgttgcctttgagtgatggtccagaaggctcaagcagtcgtcctcagatgataagagga
cgcttgtgtgatgataccaaacctgaaacatttaaccagttgtggactgttgaagaacag
aaaaagctggaacagctactcatcaaataccctcctgaagaagtagaatctcgacgctgg
cagaagatagcagatgaattgggcaacaggacagcaaaacaggttgccagccgagtacag
aagtatttcataaagctaactaaagctggcattccagtaccaggcagaacaccaaactta
tatatatactccaaaaagtcttcaacaagcagacgacagcaccctcttaataagcatctc
tttaagccttccactttcatgacttcacatgaaccgccagtgtatatggatgaagatgat
gaccgatcttgttttcatagccacatgaacactgctgttgaagatgcatcagatgacgaa
agtattcctatcatgtataggaatttacctgaatataaagaactattacagtttaaaaag
ttaaagaagcagaaacttcagcaaatgcaagctgaaagtggatttgtgcaacatgtgggc
tttaagtgtgataactgtggcatagaacccatccagggtgttcggtggcattgccaggat
tgtcctccagaaatgtctttggatttctgtgattcttgttcagactgtctacatgaaaca
gatattcacaaggaagatcaccaattagaacctatttataggtcagagacattcttagac
agagactactgtgtgtctcagggcaccagttacaattaccttgacccaaactactttcca
gcaaacagatga

DBGET integrated database retrieval system