KEGG   Homo sapiens (human): 26010Help
Entry
26010             CDS       T01001                                 

Gene name
SPATS2L, DNAPTP6, SGNP
Definition
(RefSeq) spermatogenesis associated serine rich 2 like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1387 DUF1296
Motif
Other DBs
NCBI-GeneID: 26010
NCBI-ProteinID: NP_001093892
OMIM: 613817
HGNC: 24574
Ensembl: ENSG00000196141
Vega: OTTHUMG00000154589
Pharos: Q9NUQ6(Tbio)
UniProt: Q9NUQ6 A0A024R3V0
Position
2q33.1
AA seq 558 aa AA seqDB search
MAELNTHVNVKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQAFVDGSAIQVLKEWN
MTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEAGPLQPQPPQIQNGPMNGCEKDSSSTDS
ANEKPALIPREKKISILEEPSKALRGVTEGNRLLQQKLSLDGNPKPIHGTTERSDGLQWS
AEQPCNPSKPKAKTSPVKSNTPAAHLEIKPDELAKKRGPNIEKSVKDLQRCTVSLTRYRV
MIKEEVDSSVKKIKAAFAELHNCIIDKEVSLMAEMDKVKEEAMEILTARQKKAEELKRLT
DLASQMAEMQLAELRAEIKHFVSERKYDEELGKAARFSCDIEQLKAQIMLCGEITHPKNN
YSSRTPCSSLLPLLNAHAATSGKQSNFSRKSSTHNKPSEGKAANPKMVSSLPSTADPSHQ
TMPANKQNGSSNQRRRFNPQYHNNRLNGPAKSQGSGNEAEPLGKGNSRHEHRRQPHNGFR
PKNKGGAKNQEASLGMKTPEAPAHSEKPRRRQHAADTSEARPFRGSVGRVSQCNLCPTRI
EVSTDAAVLSVPAVTLVA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactcaatactcatgtgaatgtcaaggaaaagatctatgcagttagatcagtt
gttcccaacaaaagcaataatgaaatagtcctggtgctccaacagtttgattttaatgtg
gataaagccgtgcaagcctttgtggatggcagtgcaattcaagttctaaaagaatggaat
atgacaggaaaaaagaagaacaataaaagaaaaagaagcaagtccaagcagcatcaaggc
aacaaagatgctaaagacaaggtggagaggcctgaggcagggcccctgcagccgcagcca
ccacagattcaaaacggccccatgaatggctgcgagaaggacagctcgtccacagattct
gctaacgaaaaaccagcccttatccctcgtgagaaaaagatctcgatacttgaggaacct
tcaaaggcacttcgtggggtcacagaaggcaacagactactgcaacagaaactatcctta
gatgggaaccccaaacctatacatggaacaacagagaggtcagatggcctacagtggtca
gctgagcagccttgtaacccaagcaagcctaaggcaaaaacatctcctgttaagtccaat
acccctgcagctcatcttgaaataaagccagatgagttggcaaagaaaagaggcccaaat
attgagaaatcagtgaaggatttgcaacgctgcaccgtttctctaactagatatcgcgtc
atgattaaggaagaagtggatagttccgtgaagaagatcaaagctgcctttgctgaatta
cacaactgcatcattgacaaagaagtttcattaatggcagaaatggataaagttaaagaa
gaagccatggaaatcctgactgctcgtcagaagaaagcagaagaactaaagagactcact
gaccttgccagtcagatggcagagatgcagctggccgaactcagggcagaaattaagcac
tttgtcagcgagcgtaaatatgacgaggagctcgggaaagctgcccggttttcctgtgac
atcgaacagctgaaggcccaaatcatgctctgcggagaaattacacatccaaagaacaac
tattcctcaagaactccctgcagctccctgctgcctctgctgaatgcgcacgcagcaacc
tctgggaaacagagtaacttttcccgaaaatcatccactcacaataagccctctgaaggc
aaagcggcaaaccccaaaatggtgagcagtctccccagcaccgccgacccctctcaccag
accatgccggccaacaagcagaatggatcttctaaccaaagacggagatttaatccacag
tatcataacaacaggctaaatgggcctgccaagtcgcagggcagtgggaatgaagccgag
ccactgggaaagggcaacagccgccacgaacacagaagacagccgcacaacggcttccgg
cccaaaaacaaaggcggtgccaaaaatcaagaggcttccttggggatgaagacccccgag
gccccggcccattctgaaaagccccggcgaaggcagcacgctgcagacacctcggaggcc
aggcccttccggggtagtgtcggtagggtttcacagtgcaatctctgccccacgagaata
gaagtttccacagatgcagcagttctctcagtcccggctgtgacgttggtggcctga

DBGET integrated database retrieval system