KEGG   Homo sapiens (human): 26011Help
Entry
26011             CDS       T01001                                 

Gene name
TENM4, Doc4, ETM5, ODZ4, TEN4, TNM4, Ten-M4, ten-4
Definition
(RefSeq) teneurin transmembrane protein 4
Organism
hsa  Homo sapiens (human)
Disease
H01577  Essential tremor
SSDB OrthologParalogGFIT
Motif
Pfam: Ten_N Tox-GHH EGF_2 RHS_repeat NHL hEGF CarboxypepD_reg
Motif
Other DBs
NCBI-GeneID: 26011
NCBI-ProteinID: NP_001092286
OMIM: 610084
HGNC: 29945
Ensembl: ENSG00000149256
Vega: OTTHUMG00000166770
Pharos: Q6N022(Tbio)
UniProt: Q6N022
Position
11q14.1
AA seq 2769 aa AA seqDB search
MDVKERKPYRSLTRRRDAERRYTSSSADSEEGKAPQKSYSSSETLKAYDQDARLAYGSRV
KDIVPQEAEEFCRTGANFTLRELGLEEVTPPHGTLYRTDIGLPHCGYSMGAGSDADMEAD
TVLSPEHPVRLWGRSTRSGRSSCLSSRANSNLTLTDTEHENTETDHPGGLQNHARLRTPP
PPLSHAHTPNQHHAASINSLNRGNFTPRSNPSPAPTDHSLSGEPPAGGAQEPAHAQENWL
LNSNIPLETRNLGKQPFLGTLQDNLIEMDILGASRHDGAYSDGHFLFKPGGTSPLFCTTS
PGYPLTSSTVYSPPPRPLPRSTFARPAFNLKKPSKYCNWKCAALSAIVISATLVILLAYF
VAMHLFGLNWHLQPMEGQMYEITEDTASSWPVPTDVSLYPSGGTGLETPDRKGKGTTEGK
PSSFFPEDSFIDSGEIDVGRRASQKIPPGTFWRSQVFIDHPVHLKFNVSLGKAALVGIYG
RKGLPPSHTQFDFVELLDGRRLLTQEARSLEGTPRQSRGTVPPSSHETGFIQYLDSGIWH
LAFYNDGKESEVVSFLTTAIESVDNCPSNCYGNGDCISGTCHCFLGFLGPDCGRASCPVL
CSGNGQYMKGRCLCHSGWKGAECDVPTNQCIDVACSNHGTCITGTCICNPGYKGESCEEV
DCMDPTCSGRGVCVRGECHCSVGWGGTNCETPRATCLDQCSGHGTFLPDTGLCSCDPSWT
GHDCSIEICAADCGGHGVCVGGTCRCEDGWMGAACDQRACHPRCAEHGTCRDGKCECSPG
WNGEHCTIAHYLDRVVKEGCPGLCNGNGRCTLDLNGWHCVCQLGWRGAGCDTSMETACGD
SKDNDGDGLVDCMDPDCCLQPLCHINPLCLGSPNPLDIIQETQVPVSQQNLHSFYDRIKF
LVGRDSTHIIPGENPFDGGHACVIRGQVMTSDGTPLVGVNISFVNNPLFGYTISRQDGSF
DLVTNGGISIILRFERAPFITQEHTLWLPWDRFFVMETIIMRHEENEIPSCDLSNFARPN
PVVSPSPLTSFASSCAEKGPIVPEIQALQEEISISGCKMRLSYLSSRTPGYKSVLRISLT
HPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSYYFIWDKTDVYNQKVFGLSEAFVSVGY
EYESCPDLILWEKRTTVLQGYEIDASKLGGWSLDKHHALNIQSGILHKGNGENQFVSQQP
PVIGSIMGNGRRRSISCPSCNGLADGNKLLAPVALTCGSDGSLYVGDFNYIRRIFPSGNV
TNILELRNKDFRHSHSPAHKYYLATDPMSGAVFLSDSNSRRVFKIKSTVVVKDLVKNSEV
VAGTGDQCLPFDDTRCGDGGKATEATLTNPRGITVDKFGLIYFVDGTMIRRIDQNGIIST
LLGSNDLTSARPLSCDSVMDISQVHLEWPTDLAINPMDNSLYVLDNNVVLQISENHQVRI
VAGRPMHCQVPGIDHFLLSKVAIHATLESATALAVSHNGVLYIAETDEKKINRIRQVTTS
GEISLVAGAPSGCDCKNDANCDCFSGDDGYAKDAKLNTPSSLAVCADGELYVADLGNIRI
RFIRKNKPFLNTQNMYELSSPIDQELYLFDTTGKHLYTQSLPTGDYLYNFTYTGDGDITL
ITDNNGNMVNVRRDSTGMPLWLVVPDGQVYWVTMGTNSALKSVTTQGHELAMMTYHGNSG
LLATKSNENGWTTFYEYDSFGRLTNVTFPTGQVSSFRSDTDSSVHVQVETSSKDDVTITT
NLSASGAFYTLLQDQVRNSYYIGADGSLRLLLANGMEVALQTEPHLLAGTVNPTVGKRNV
TLPIDNGLNLVEWRQRKEQARGQVTVFGRRLRVHNRNLLSLDFDRVTRTEKIYDDHRKFT
LRILYDQAGRPSLWSPSSRLNGVNVTYSPGGYIAGIQRGIMSERMEYDQAGRITSRIFAD
GKTWSYTYLEKSMVLLLHSQRQYIFEFDKNDRLSSVTMPNVARQTLETIRSVGYYRNIYQ
PPEGNASVIQDFTEDGHLLHTFYLGTGRRVIYKYGKLSKLAETLYDTTKVSFTYDETAGM
LKTINLQNEGFTCTIRYRQIGPLIDRQIFRFTEEGMVNARFDYNYDNSFRVTSMQAVINE
TPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIITTAVMTHTKHFDAYGRMKEVQYEIFR
SLMYWMTVQYDNMGRVVKKELKVGPYANTTRYSYEYDADGQLQTVSINDKPLWRYSYDLN
GNLHLLSPGNSARLTPLRYDIRDRITRLGDVQYKMDEDGFLRQRGGDIFEYNSAGLLIKA
YNRAGSWSVRYRYDGLGRRVSSKSSHSHHLQFFYADLTNPTKVTHLYNHSSSEITSLYYD
LQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGLMIKQILYTAYGEIYMDTNPNFQIII
GYHGGLYDPLTKLVHMGRRDYDVLAGRWTSPDHELWKHLSSSNVMPFNLYMFKNNNPISN
SQDIKCFMTDVNSWLLTFGFQLHNVIPGYPKPDMDAMEPSYELIHTQMKTQEWDNSKSIL
GVQCEVQKQLKAFVTLERFDQLYGSTITSCQQAPKTKKFASSGSVFGKGVKFALKDGRVT
TDIISVANEDGRRVAAILNHAHYLENLHFTIDGVDTHYFVKPGPSEGDLAILGLSGGRRT
LENGVNVTVSQINTVLNGRTRRYTDIQLQYGALCLNTRYGTTLDEEKARVLELARQRAVR
QAWAREQQRLREGEEGLRAWTEGEKQQVLSTGRVQGYDGFFVISVEQYPELSDSANNIHF
MRQSEMGRR
NT seq 8310 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgaaggagaggaagccttaccgctcgctgacccggcgccgcgacgccgagcgc
cgctacaccagctcgtccgcggacagcgaggagggcaaagccccgcagaaatcgtacagc
tccagcgagaccctgaaggcctacgaccaggacgcccgcctagcctatggcagccgcgtc
aaggacattgtgccgcaggaggccgaggaattctgccgcacaggtgccaacttcaccctg
cgggagctggggctggaagaagtaacgccccctcacgggaccctgtaccggacagacatt
ggcctcccccactgcggctactccatgggggctggctctgatgccgacatggaggctgac
acggtgctgtcccctgagcaccccgtgcgtctgtggggccggagcacacggtcagggcgc
agctcctgcctgtccagccgggccaattccaatctcacactcaccgacaccgagcatgaa
aacactgagactgatcatccgggcggcctgcagaaccacgcgcggctccggacgccgccg
ccgccgctctcgcacgcccacacccccaaccagcaccacgcggcctccattaactccctg
aaccggggcaacttcacgccgaggagcaaccccagcccggcccccacggaccactcgctc
tccggagagccccctgccggcggcgcccaggagcctgcccacgcccaggagaactggctg
ctcaacagcaacatccccctggagaccagaaacctaggcaagcagccattcctagggaca
ttgcaggacaacctcattgagatggacattctcggcgcctcccgccatgatggggcttac
agtgacgggcacttcctcttcaagcctggaggcacctccccgctcttctgcaccacatca
ccagggtacccactgacgtccagcacagtgtactctcctccgccccgacccctgccccgc
agcaccttcgcccggccggcctttaacctcaagaagccctccaagtactgtaactggaag
tgcgcagccctgagcgccatcgtcatctcagccactctggtcatcctgctggcatacttt
gtggccatgcacctgtttggcctaaactggcacctgcagccgatggaggggcagatgtat
gagatcacggaggacacagccagcagttggcctgtgccaaccgacgtctccctatacccc
tcagggggcactggcttagagacccctgacaggaaaggcaaaggaaccacagaaggaaag
cccagtagtttctttccagaggacagtttcatagattctggagaaattgatgtgggaagg
cgagcttcccagaagattcctcctggcactttctggagatctcaagtgttcatagaccat
cctgtgcatctgaaattcaatgtgtctctgggaaaggcagccctggttggcatttatggc
agaaaaggcctccctccttcacatacacagtttgactttgtggagctgctggatggcagg
aggctcctaacccaggaggcgcggagcctagaggggaccccgcgccagtctcggggaact
gtgcccccctccagccatgagacaggcttcatccagtatttggattcaggaatctggcac
ttggctttttacaatgacggaaaggagtcagaagtggtttcctttctcaccactgccatt
gagtcggtggataactgccccagcaactgctatggcaatggtgactgcatctctgggacc
tgccactgcttcctgggtttcctgggccccgactgtggcagagcctcctgccccgtgctc
tgtagcggaaatggccaatacatgaaaggcagatgcttgtgccacagtggctggaaaggc
gctgagtgcgatgtgcccaccaaccagtgtatcgatgtggcctgcagcaaccatggcacc
tgcatcacgggcacctgcatctgcaaccctggctacaagggcgagagctgtgaggaagtg
gactgcatggaccccacatgttcaggccggggtgtctgcgtgagaggcgaatgccactgc
tctgtgggatggggaggcaccaactgcgagacccccagggccacatgcttagaccagtgt
tcaggccacggaaccttcctcccggacaccgggctttgcagctgtgacccaagctggact
ggacacgactgttctatcgagatctgtgctgccgactgtggtggccatggcgtgtgcgta
gggggcacctgccgctgcgaggatggctggatgggggcagcctgcgaccagcgggcctgc
cacccgcgctgtgccgagcatgggacctgccgcgacggcaagtgcgagtgcagccctggc
tggaatggcgaacactgcaccatcgctcactatctggatagggtagttaaagagggttgc
cctgggttgtgcaatggcaacggcagatgtaccttagacctgaatggttggcactgcgtc
tgccagctgggctggagaggagctggctgtgacacttccatggagactgcctgcggtgac
agcaaagacaatgatggagatggcctggtggactgcatggaccctgactgctgcctccag
cccctgtgccatatcaacccgctgtgccttggctcccctaaccctctggacatcatccag
gagacacaggtccctgtgtcacagcagaacctacactccttctatgaccgcatcaagttc
ctcgtgggcagggacagcacgcacataatccccggggagaacccctttgatggagggcat
gcttgtgttattcgtggccaagtgatgacatcagatggaacccccctggttggtgtgaac
atcagttttgtcaataaccctctctttggatatacaatcagcaggcaagatggcagcttt
gacttggtgacaaatggcggcatctccatcatcctgcggttcgagcgggcacctttcatc
acacaggagcacaccctgtggctgccatgggatcgcttctttgtcatggaaaccatcatc
atgagacatgaggagaatgagattcccagctgtgacctgagcaattttgcccgccccaac
ccagtcgtctctccatccccactgacgtccttcgccagctcctgtgcagagaaaggcccc
attgtgccggaaattcaggctttgcaggaggaaatctctatctctggctgcaagatgagg
ctgagctacctgagcagccggacccctggctacaaatctgtcctgaggatcagcctcacc
cacccgaccatccccttcaacctcatgaaggtgcacctcatggtagcggtggagggccgc
ctcttcaggaagtggttcgctgcagccccagacctgtcctattatttcatttgggacaag
acagacgtctacaaccagaaggtgtttgggctttcagaagcctttgtttccgtgggttat
gaatatgaatcctgcccagatctaatcctgtgggaaaaaagaacaacagtgctgcagggc
tatgaaattgacgcgtccaagcttggaggatggagcctagacaaacatcatgccctcaac
attcaaagtggcatcctgcacaaagggaatggggagaaccagtttgtgtctcagcagcct
cctgtcattgggagcatcatgggcaatgggcgccggagaagcatctcctgccccagctgc
aacggccttgctgacggcaacaagctcctggccccagtggccctcacctgtggctctgac
gggagcctctatgtgggtgatttcaactacattagaaggatcttcccctctggaaatgtc
accaacatcctagagctgagaaataaagatttcagacatagtcacagtccagcacacaaa
tactacctggccacagaccccatgagtggggccgtcttcctttctgacagcaacagccgg
cgggtctttaaaatcaagtccactgtggtggtgaaggaccttgtcaagaactctgaggtg
gttgcggggacaggtgaccagtgcctcccctttgatgacactcgctgcggggatggtggg
aaggccacagaagccacactcaccaatcccaggggcattacagtggacaagtttgggctg
atctacttcgtggatggcaccatgatcagacgcatcgatcagaatgggatcatctccacc
ctgctcggctctaatgatctcacatcagcccggccactcagctgtgattctgtcatggat
atttcccaggttcacctggagtggcccacagacttagccatcaacccaatggacaactca
ctttatgtcctcgacaacaatgtggtcctgcaaatctctgaaaaccaccaggtgcgcatt
gtcgccgggaggcccatgcactgccaggtccctggcattgaccacttcctgctaagcaag
gtggccatccacgcaaccctggagtcagccaccgctttggctgtttcacacaatggggtc
ctgtatattgctgagactgatgagaaaaagatcaaccgcatcaggcaggtcaccactagt
ggagagatctcactcgttgctggggcccccagtggctgtgactgtaaaaatgatgccaac
tgtgattgtttttctggagacgatggttatgccaaggatgcaaagttaaataccccatct
tccttggctgtgtgtgctgatggggagctctacgtggccgaccttgggaacatccgaatt
cggtttatccggaagaacaagcctttcctcaacacccagaacatgtatgagctgtcttca
ccaattgaccaggagctctatctgtttgataccaccggcaagcacctgtacacccaaagc
ctgcccacaggagactacctgtacaacttcacctacactggggacggcgacatcacactc
atcacagacaacaatggcaacatggtaaatgtccgccgagactctactgggatgcccctc
tggctggtggtcccagatggccaggtgtactgggtgaccatgggcaccaacagtgcactc
aagagtgtgaccacacaaggacacgagttggccatgatgacataccatggcaattccggc
cttctggcaaccaaaagcaatgaaaacggatggacaacattttatgagtacgacagcttt
ggccgcctgacaaatgtgaccttccctactggccaggtgagcagtttccgaagtgataca
gacagttcagtgcatgtccaggtagagacctccagcaaggatgatgtcaccataaccacc
aacctgtctgcctcaggcgccttctacacactgctgcaagaccaagtccggaacagctac
tacatcggggccgatggctccttgcggctgctgctggccaacggcatggaggtggcgctg
cagactgagccccacttgctggctggcaccgtcaaccccaccgtgggcaagaggaatgtc
acgctgcccatcgacaacggcctcaacctggtggagtggcgccagcgcaaagagcaggct
cggggccaggtcactgtctttgggcgccggctgcgggttcacaaccgaaatctcctatct
ctggactttgatcgcgtaacacgcacagagaagatctatgatgaccaccgcaagttcacc
cttcggattctgtacgaccaggcggggcggcccagcctctggtcacccagcagcaggctg
aatggtgtcaacgtgacatactcccctgggggttacattgctggcatccagaggggcatc
atgtctgaaagaatggaatacgaccaggcgggccgcatcacatccaggatcttcgctgat
gggaagacatggagctacacatacttagagaagtccatggtgctgctactacacagccag
aggcagtatatctttgagttcgacaagaatgaccgcctctcttctgtgacgatgcccaac
gtggcgcggcagacactagagaccatccgctcagtgggctactacagaaacatctatcag
ccccctgagggcaatgcctcagtcatacaggacttcactgaggatgggcacctccttcac
accttctacctgggcactggccgcagggtgatatacaagtatggcaaactgtcaaagctg
gcagagacgctctatgacaccaccaaggtcagtttcacctatgacgagacggcaggcatg
ctgaagaccatcaacctacagaatgagggcttcacctgcaccatccgctaccgtcagatt
gggcccctgattgaccgacagatcttccgcttcactgaggaaggcatggtcaacgcccgt
tttgactacaactatgacaacagcttccgggtgaccagcatgcaggctgtgatcaacgag
accccactgcccattgatctctatcgctatgatgatgtgtcaggcaagacagagcagttt
gggaagtttggtgtcatttactatgacattaaccagatcatcaccacagctgtcatgacc
cacaccaagcattttgatgcatatggcaggatgaaggaagtgcagtatgagatcttccgc
tcgctcatgtactggatgaccgtccagtatgataacatggggcgagtagtgaagaaggag
ctgaaggtaggaccctacgccaataccactcgctactcctatgagtatgatgctgacggc
cagctgcagacagtctccatcaatgacaagccactctggcgctacagctacgacctcaat
gggaacctgcacttactgagccctgggaacagtgcacggctcacaccactacggtatgac
atccgcgaccgcatcactcggctgggtgacgtgcaatacaagatggatgaggatggcttc
ctgaggcagcggggcggtgatatctttgagtacaactcagctggcctgctcatcaaggcc
tacaaccgggctggcagctggagtgtcaggtaccgctacgatggcctggggcggcgcgtg
tccagcaagagcagccacagccaccacctgcagttcttctatgcagacctgaccaacccc
accaaggtcacccacctgtacaaccactccagctctgagatcacctccctctactacgac
ttgcaaggacacctctttgccatggagctgagcagtggtgatgagttttacatagcttgt
gacaacatcgggacccctcttgctgtctttagtggaacaggtttgatgatcaagcaaatc
ctgtacacagcctatggggagatctacatggataccaaccccaactttcagatcatcata
ggctaccatggtggcctctatgatccactcaccaagcttgtccacatgggccggcgagat
tatgatgtgctggccggacgctggactagcccagaccacgagctgtggaagcaccttagt
agcagcaacgtcatgccttttaatctctatatgttcaaaaacaacaaccccatcagcaac
tcccaggacatcaagtgcttcatgacagatgttaacagctggctgctcacctttggattc
cagctacacaacgtgatccctggttatcccaaaccagacatggatgccatggaaccctcc
tacgagctcatccacacacagatgaaaacgcaggagtgggacaacagcaagtctatcctc
ggggtacagtgtgaagtacagaagcagctcaaggcctttgtcaccttagaacggtttgac
cagctctatggctccacaatcaccagctgccagcaggctccaaagaccaagaagtttgca
tccagcggctcagtctttggcaagggggtcaagtttgccttgaaggatggccgagtgacc
acagacatcatcagtgtggccaatgaggatgggcgaagggttgctgccatcttgaaccat
gcccactacctagagaacctgcacttcaccattgatggggtggatacccattactttgtg
aaaccaggaccttcagaaggtgacctggccatcctgggcctcagtggggggcggcgaacc
ctggagaatggggtcaacgtcactgtgtcccagatcaacacagtacttaatggcaggact
agacgctacacagacatccagctccagtacggggcactgtgcttgaacacacgctacggg
acaacgttggatgaggagaaggcacgggtcctggagctggcccggcagagagccgtgcgc
caagcgtgggcccgcgagcagcagagactgcgggaaggggaggaaggcctgcgggcctgg
acagagggggagaagcagcaggtgctgagcacagggcgggtgcaaggctacgacggcttt
ttcgtgatctctgtcgagcagtacccagaactgtcagacagcgccaacaacatccacttc
atgagacagagcgagatgggccggaggtga

DBGET integrated database retrieval system