KEGG   Homo sapiens (human): 26013
Entry
26013             CDS       T01001                                 

Gene name
L3MBTL1, H-L(3)MBT, L3MBTL, ZC2HC3, dJ138B7.3
Definition
(RefSeq) L3MBTL histone methyl-lysine binding protein 1
  KO
K24387  lethal(3)malignant brain tumor-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    26013 (L3MBTL1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2HisCys zinc factors
    26013 (L3MBTL1)
SSDB
Motif
Pfam: MBT zf-C2HC
Other DBs
NCBI-GeneID: 26013
NCBI-ProteinID: NP_115479
OMIM: 608802
HGNC: 15905
Ensembl: ENSG00000185513 ENSG00000288000
Vega: OTTHUMG00000032503
Pharos: Q9Y468(Tchem)
UniProt: Q9Y468
Structure
PDB: 

Position
20q13.12
AA seq 840 aa
MHLVAGDSPGSGPHLPATAFIIPASSATLGLPSSALDVSCFPREPIHVGAPEQVAGCEPV
SATVLPQLSAGPASSSTSTVRLLEWTEAAAPPPGGGLRFRISEYKPLNMAGVEQPPSPEL
RQEGVTEYEDGGAPAGDGEAGPQQAEDHPQNPPEDPNQDPPEDDSTCQCQACGPHQAAGP
DLGSSNDGCPQLFQERSVIVENSSGSTSASELLKPMKKRKRREYQSPSEEESEPEAMEKQ
EEGKDPEGQPTASTPESEEWSSSQPATGEKKECWSWESYLEEQKAITAPVSLFQDSQAVT
HNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHP
AGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLE
AVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTP
PQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVE
DVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSASPGGCP
PLSYRSLPHTRTSKYSFHHRKCPTPGCDGSGHVTGKFTAHHCLSGCPLAERNQSRLKAEL
SDSEASARKKNLSGFSPRKKPRHHGRIGRPPKYRKIPQEDFQTLTPDVVHQSLFMSALSA
HPDRSLSVCWEQHCKLLPGVAGISASTVAKWTIDEVFGFVQTLTGCEDQARLFKDEARIV
RVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETGVHSLLCSLPTHLLAKLSFASDSQY
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgcacttggtggccggagacagccccggttctggtcctcacctgcccgcaactgccttc
atcattccagccagttcggccaccctcggcctgcccagcagtgccctggatgtgtcttgc
tttccccgggagccaatccatgtgggtgccccggagcaagtggccggctgcgaaccagtt
tctgccaccgtcctgccgcagcttagcgccgggccggccagctccagcaccagcacagtg
cggcttctggaatggacagaggccgcggccccgcccccagggggcggcctgcggttccgg
ataagcgagtataagccgctgaacatggcgggagtggagcagcccccgagccccgagctg
cggcaggaaggcgtgaccgaatacgaagatggcggggccccggcgggagatggcgaggcg
ggcccccaacaggcggaggaccacccccagaatcctccagaagatcccaatcaggacccc
ccagaggatgatagcacctgtcagtgccaggcgtgcgggcctcaccaagccgcgggtcca
gatcttggttcctctaatgatggctgccctcagctgttccaggagcggtcagtcatagtg
gagaactcctcaggctctaccagcgcttctgagctcctcaaacccatgaagaagaggaag
cgcagggaataccagagcccatcagaggaggagtcggagccagaggccatggagaagcaa
gaagaaggaaaggacccagagggacaacccactgctagcaccccagagagtgaggagtgg
agcagcagccagcctgcaacaggtgagaagaaggaatgctggtcgtgggagtcctaccta
gaggagcagaaggccattactgctccagtcagcctcttccaggactcccaggcagtcact
cacaacaagaatggcttcaaactgggcatgaagttggaaggcattgaccctcaacacccg
tccatgtacttcatcctcaccgtggctgaggtatgtggctatcgcctacgcctgcacttt
gatgggtattctgagtgccatgacttctgggtcaatgccaactcccctgacattcaccct
gctggctggttcgagaagacgggccacaagctgcagcctcccaaaggttacaaggaggag
gagttcagctggagccagtacctgcgcagcacaagagctcaggctgcccccaagcacctg
tttgtgagccagagccacagtcccccacccctgggcttccaggtgggcatgaagctggag
gctgttgaccgcatgaacccgtcccttgtctgcgtggccagtgtgaccgatgtggtggac
agccgcttcctggtgcactttgacaactgggatgatacttatgactactggtgtgatccc
agcagcccctacatccacccagtgggctggtgccagaagcaaggaaagcccctcacccct
ccacaagactacccagaccctgataacttctgttgggagaaatatctggaagaaactggg
gcctctgctgtccccacctgggccttcaaggtgcgaccccctcacagcttcctggtcaat
atgaagctggaggctgtggaccgcaggaacccagccctgattcgcgtggccagcgtggag
gatgtggaggaccatcggataaagatccactttgatggctggagtcatggctatgatttc
tggatcgacgctgaccacccagacatccaccctgccggctggtgctccaagacaggacat
cccctgcagcctcctctcggacccagagagcccagctctgcctcccctgggggctgtccc
cctctcagctataggagcctgccccacactaggacctccaaatacagctttcaccaccgg
aagtgccccactcctggttgcgacggctctggccatgtcacaggcaagttcacagctcac
cattgcctctcaggctgcccactggctgagaggaaccagagccggctgaaagcggagctg
tctgactcggaggcctcagcccgcaagaagaacctctcaggcttctccccaaggaagaag
cctcgccatcacggccgaattggacgccctccgaagtatcgaaagattccgcaggaagat
ttccagaccctcacgcccgatgtcgtgcaccagtccctcttcatgtcagccctgtcggcc
caccctgaccgctcactctcagtgtgctgggagcagcactgcaagctcctgccaggagta
gcgggcatctcagcctcgacagtcgccaagtggaccatcgatgaggtcttcggctttgtt
cagaccctgacaggttgtgaggaccaagcacgcctcttcaaagacgaggcaagaatagtc
agagtgacccatgtatctgggaagactctagtctggactgtggcccagcttggggacctt
gtgtgctcagatcatcttcaggaaggaaaaggcatcctggagacaggagtccattcactc
ctctgctctctacccactcatttgcttgccaaacttagctttgccagtgatagtcaatat
taa

DBGET integrated database retrieval system