KEGG   Homo sapiens (human): 26015
Entry
26015             CDS       T01001                                 
Symbol
RPAP1
Name
(RefSeq) RNA polymerase II associated protein 1
  KO
K20826  RNA polymerase II-associated protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    26015 (RPAP1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     26015 (RPAP1)
SSDB
Motif
Pfam: RPAP1_C RPAP1_N ATP-synt_B
Other DBs
NCBI-GeneID: 26015
NCBI-ProteinID: NP_056355
OMIM: 611475
HGNC: 24567
Ensembl: ENSG00000103932
Pharos: Q9BWH6(Tdark)
UniProt: Q9BWH6 A8K2F9
Position
15:complement(41517176..41544257)
AA seq 1393 aa
MLSRPKPGESEVDLLHFQSQFLAAGAAPAVQLVKKGNRGGGDANSDRPPLQDHRDVVMLD
NLPDLPPALVPSPPKRARPSPGHCLPEDEDPEERLRRHDQHITAVLTKIIERDTSSVAVN
LPVPSGVAFPAVFLRSRDTQGKSATSGKRSIFAQEIAARRIAEAKGPSVGEVVPNVGPPE
GAVTCETPTPRNQGCQLPGSSHSFQGPNLVTGKGLRDQEAEQEAQTIHEENIARLQAMAP
EEILQEQQRLLAQLDPSLVAFLRSHSHTQEQTGETASEEQRPGGPSANVTKEEPLMSAFA
SEPRKRDKLEPEAPALALPVTPQKEWLHMDTVELEKLHWTQDLPPVRRQQTQERMQARFS
LQGELLAPDVDLPTHLGLHHHGEEAERAGYSLQELFHLTRSQVSQQRALALHVLAQVISR
AQAGEFGDRLAGSVLSLLLDAGFLFLLRFSLDDRVDGVIATAIRALRALLVAPGDEELLD
STFSWYHGALTFPLMPSQEDKEDEDEDEECPAGKAKRKSPEEESRPPPDLARHDVIKGLL
ATSLLPRLRYVLEVTYPGPAVVLDILAVLIRLARHSLESATRVLECPRLIETIVREFLPT
SWSPVGAGPTPSLYKVPCATAMKLLRVLASAGRNIAARLLSSFDLRSRLCRIIAEAPQEL
ALPPEEAEMLSTEALRLWAVAASYGQGGYLYRELYPVLMRALQVVPRELSTHPPQPLSMQ
RIASLLTLLTQLTLAAGSTPAETISDSAEASLSATPSLVTWTQVSGLQPLVEPCLRQTLK
LLSRPEMWRAVGPVPVACLLFLGAYYQAWSQQPSSCPEDWLQDMQRLSEELLLPLLSQPT
LGSLWDSLRHCSLLCNPLSCVPALEAPPSLVSLGCSGGCPRLSLAGSASPFPFLTALLSL
LNTLAQIHKGLCGQLAAILAAPGLQNYFLQCVAPGAAPHLTPFSAWALRHEYHLQYLALA
LAQKAAALQPLPATHAALYHGMALALLSRLLPGSEYLTHELLLSCVFRLEFLPERTSGGP
EAADFSDQLSLGSSRVPRCGQGTLLAQACQDLPSIRNCYLTHCSPARASLLASQALHRGE
LQRVPTLLLPMPTEPLLPTDWPFLPLIRLYHRASDTPSGLSPTDTMGTAMRVLQWVLVLE
SWRPQALWAVPPAARLARLMCVFLVDSELFRESPVQHLVAALLAQLCQPQVLPNLNLDCR
LPGLTSFPDLYANFLDHFEAVSFGDHLFGALVLLPLQRRFSVTLRLALFGEHVGALRALS
LPLTQLPVSLECYTVPPEDNLALLQLYFRTLVTGALRPRWCPVLYAVAVAHVNSFIFSQD
PQSSDEVKAARRSMLQKTWLLADEGLRQHLLHYKLPNSTLPEGFELYSQLPPLRQHYLQR
LTSTVLQNGVSET
NT seq 4182 nt   +upstreamnt  +downstreamnt
atgctgtcgagaccgaagccaggggagtccgaggtggacctgctgcacttccagagtcag
tttctcgcagctggtgcagccccagcagtgcagttggtgaagaaaggaaataggggcggt
ggtgatgccaactcagaccggcctccgctccaggaccatcgggatgtggtgatgttggac
aatctcccagatttgcccccagctttggtcccttctcctccaaagagagccaggcccagc
cctggccactgcctgcctgaggatgaggacccagaagagaggctgaggaggcatgatcag
cacatcactgctgtcttgactaagattattgaacgagatacaagttcagtggccgtgaat
ctgcctgtgcccagtggtgttgctttccctgctgtgttccttcgctcgcgggacacacag
gggaaatcagcaacatctggtaagagaagcatctttgcccaggaaattgcggcaaggagg
atagctgaagccaagggcccatcagttggggaagttgtgcccaacgtgggcccaccagag
ggtgccgtgacctgtgagacacccactcctaggaaccagggctgccagcttcctgggagc
agccacagctttcagggacccaatctggtcacagggaaggggctcagggatcaagaagct
gagcaggaagcccagactatccatgaagagaacatagcaagactgcaggccatggctcct
gaggagatcctgcaggaacagcagcggttgctggcccagcttgaccccagcttggttgct
ttcttgagatctcacagccacacgcaagagcaaacaggagagacagcctctgaggagcag
aggccaggaggaccctctgctaatgtcaccaaggaggaacccctcatgtcagcttttgcc
agtgagcccaggaagagagacaagctggagccagaagccccagctctggcattgcccgtg
acccctcagaaagaatggctgcacatggacactgtcgagctggagaagctccactggacc
caggacttgccccctgtccggcggcagcagacacaggagaggatgcaggctcgattcagt
cttcagggagaactactggcccctgacgtggacctgcccacccacctgggtctgcaccac
catggagaggaggcagagagagcggggtattccctacaggagctgttccacctgacccgc
agccaggtttcccagcagagagcactggcactgcatgtgttagcccaggtcatcagcagg
gcccaggctggtgagtttggggaccggctagcaggcagtgtcttaagcctccttttggat
gctggtttcctcttcctactgcgcttctccttggatgacagagtggatggggtcattgca
accgccatccgtgctcttcgggctctgctggtggctcctggagatgaggagctcctcgac
agcaccttctcttggtaccatggagctttgacgttccctctgatgcccagccaggaggac
aaggaggatgaggacgaggatgaagaatgcccagcaggaaaagcaaaaaggaaaagccct
gaagaagaaagccggcctccacctgacctggcccgacatgatgtcatcaaggggctcctg
gctaccagcctgctgcctcggctgcgctacgtgctggaggtgacatacccaggacctgcg
gtggtccttgacatcctggctgtgctcatccgcctggcccggcattccctggaatcagcc
acaagggtcctggagtgccctcggctgatagagactatagttcgagagttcttgcccacc
agttggtctcctgtgggggcagggcctacccctagtctatacaaagtaccctgtgctact
gccatgaaactacttcgtgtcctggcctcagctgggaggaatattgctgcccggctgttg
agcagctttgatctccggagccgcctgtgccgcatcatagctgaggctccccaagaactg
gccttgcccccagaggaagctgagatgctgagcaccgaggccctccgtctgtgggctgtg
gctgcctcctatggccagggcggttacctttacagggagctctacccagtgctgatgcgg
gccttgcaggtggtgccgcgggagctcagcacccacccacctcaacccctgtccatgcag
cggatagcctcactgctcactctcctcacccagctaaccctggcagccggcagtacccct
gctgaaaccatcagtgattctgctgaggccagcctctcggccaccccttccttagtcact
tggacacaggtgtctgggctccagcctcttgttgagccgtgtctaaggcagaccttgaag
ttgctgtccagacctgagatgtggagagccgtgggcccagtgcccgttgcctgcctgttg
ttcctgggagcctactaccaggcctggagccagcaaccaagctcatgcccggaggattgg
ctccaggacatgcagcgcctgtcagaggagctgctgctgccactgctgagtcagcccaca
ctgggcagcctgtgggattcccttaggcactgctcccttctctgcaacccgctgtcctgt
gtgccagcccttgaagctccccccagcctcgtgtcactgggctgctcgggaggctgcccc
cgtctcagtctggctggctcagcctcacccttcccattcctcactgccctcctctctctt
cttaataccctggcccagatccacaaggggctgtgtggccagctggctgccatattggct
gccccgggactccagaattacttcctccagtgtgtggctcctggggctgccccacacctc
acacctttctctgcatgggccctgcgccatgagtaccacctgcagtacctggcactcgct
ctggcccagaaagcggcagcgctgcagccactgccagccacccatgctgccctctatcat
ggtatggccttggccctgctgagccggctgctgcccggaagtgagtacctcacccatgag
ctgctgctgagctgtgtattccggctggagttcctcccggaaagaacatcagggggtcca
gaggcagccgacttctctgaccagctgtcgttaggaagcagcagggtccctcggtgtggg
caagggactctgctggctcaggcctgccaggacctccccagcatccgcaactgctacctg
actcattgctcgccagcccgagccagtctgctggcctcccaggctctgcaccgaggggag
ctacagcgagtcccaaccctgctactgcccatgcctacggagccgctgctgcccaccgac
tggcccttcctgccactgattcgcctctaccaccgggcttcagacaccccctcgggactc
tctcccacagacaccatgggcacagccatgcgggtcctgcagtgggtgctagttttggag
agctggcgcccccaggctctctgggctgtgccccctgctgcccgcctggcacggctcatg
tgtgtgttcctggtggacagtgagctgttccgggagtccccagtacagcatctggtggca
gccctcctcgcccagctctgtcagcctcaagtcttgccaaacctcaacctggactgccga
ctccctggcctgacgtctttccctgacctctatgccaacttcctggatcattttgaggct
gtctcttttggggaccacctctttggggccctggtcctcctgcccctgcagcgtcggttc
agtgtcaccttgcgccttgccctctttggggaacacgtgggagccttgcgagctctgagc
ctgcctctgacccagttgcctgtgtccctggagtgttacacagtgcctcctgaagacaac
ctggccctccttcagctctacttccggaccctggttactggtgcgctccgcccacgttgg
tgccccgtgctctatgctgtggctgtggctcatgtcaatagcttcatcttctctcaggac
ccacagagctcagatgaggtcaaagctgcccgcaggagtatgctgcagaaaacatggctg
ctggcagatgagggtctccggcagcacctcctgcactataagcttcccaattccacgctc
ccagagggctttgagctctattctcagttgccccctctgcgtcagcactacctccagaga
ctgacttcaacagtgctccaaaatggggtatcagagacctag

DBGET integrated database retrieval system