KEGG   Homo sapiens (human): 26022Help
Entry
26022             CDS       T01001                                 

Gene name
TMEM98, TADA1
Definition
(RefSeq) transmembrane protein 98
Organism
hsa  Homo sapiens (human)
Disease
H02172  Nanophthalmos
SSDB OrthologParalogGFIT
Motif
Pfam: GCIP FAM163
Motif
Other DBs
NCBI-GeneID: 26022
NCBI-ProteinID: NP_001028676
OMIM: 615949
HGNC: 24529
Ensembl: ENSG00000006042
Vega: OTTHUMG00000132882
Pharos: Q9Y2Y6(Tdark)
UniProt: Q9Y2Y6
Position
17q11.2
AA seq 226 aa AA seqDB search
METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPS
ELELDDVVITNPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMK
TSASVSDIIVVAKRISPRVDDVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLT
GGLDWIDQSLSAAEEHLEVLREAALASEPDKGLPGPEGFLQEQSAI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggagactgtggtgattgttgccataggtgtgctggccaccatctttctggcttcgttt
gcagccttggtgctggtttgcaggcagcgctactgccggccgcgagacctgctgcagcgc
tatgattctaagcccattgtggacctcattggtgccatggagacccagtctgagccctct
gagttagaactggacgatgtcgttatcaccaacccccacattgaggccattctggagaat
gaagactggatcgaagatgcctcgggtctcatgtcccactgcattgccatcttgaagatt
tgtcacactctgacagagaagcttgttgccatgacaatgggctctggggccaagatgaag
acttcagccagtgtcagcgacatcattgtggtggccaagcggatcagccccagggtggat
gatgttgtgaagtcgatgtaccctccgttggaccccaaactcctggacgcacggacgact
gccctgctcctgtctgtcagtcacctggtgctggtgacaaggaatgcctgccatctgacg
ggaggcctggactggattgaccagtctctgtcggctgctgaggagcatttggaagtcctt
cgagaagcagccctagcttctgagccagataaaggcctcccaggccctgaaggcttcctg
caggagcagtctgcaatttag

DBGET integrated database retrieval system