KEGG   Homo sapiens (human): 26031
Entry
26031             CDS       T01001                                 

Gene name
OSBPL3, ORP-3, ORP3, OSBP3
Definition
(RefSeq) oxysterol binding protein like 3
  KO
K20463  oxysterol-binding protein-related protein 3/6/7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26031 (OSBPL3)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    26031 (OSBPL3)
SSDB
Motif
Pfam: Oxysterol_BP PH_8 PH PH_3
Other DBs
NCBI-GeneID: 26031
NCBI-ProteinID: NP_056365
OMIM: 606732
HGNC: 16370
Ensembl: ENSG00000070882
Vega: OTTHUMG00000023277
Pharos: Q9H4L5(Tbio)
UniProt: Q9H4L5
Position
7p15.3
AA seq 887 aa
MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLK
KRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTE
EHIYHLKVKSEEVFDEWVSKLRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSIS
SRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLL
QSMDVLHRTYSAPAINAIQGGSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVR
LHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREK
LKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNL
AEENSRDENRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEISDDDSYVSDISD
NLSLDNLSNDLDNERQTLGPVLDSGREAKSRRRTCLPAPCPSSSNISLWNILRNNIGKDL
SKVAMPVELNEPLNTLQRLCEELEYSELLDKAAQIPSPLERMVYVAAFAISAYASSYYRA
GSKPFNPVLGETYECIREDKGFQFFSEQVSHHPPISACHAESRNFVFWQDVRWKNKFWGK
SMEIVPIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHYGEIVIKNLHDDSCYCKV
NFIKAKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGGSSSACVWRANPMPKGYE
QYYSFTQFALELNEMDPSSKSLLPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQRERR
RVLEENHVEHQPRFFRKSDDDSWVSNGTYLELRKDLGFSKLDHPVLW
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgatgagtgatgagaagaaccttggtgtgtcccaaaaattggtatcaccttcaaggagc
acaagtagctgctcttccaagcaaggaagtcgacaggacagctgggaagtggtggaagga
ctgaggggggagatgaattacacccaggagccaccagttcagaaaggatttttgctgaaa
aagaggaagtggcccttaaaaggctggcataagagattcttctatctggacaaaggaatc
ttgaaatatgccaagagccaaaccgatatagagagagagaagctgcatggctgcattgat
gtcgggctctcagtgatgtctgtaaagaagtcatcaaaatgcatagaccttgacaccgag
gagcacatctaccatctgaaggtcaagtcagaagaagtctttgatgagtgggtatcgaaa
cttcgccaccacagaatgtatcgtcagaatgaaattgccatgtttccacatgaagttaac
cactttttctcagggtccaccatcacagactcttcatctggggtgtttgactccatttca
agtaggaagcgtagcagtatatcaaagcagaatttatttcaaactggaagcaatgtatca
ttttcttgtggtggtgagacacgagttccattatggttacagtcttcagaggacatggaa
aaatgctccaaagacctggcgcactgtcatgcctacctggtagaaatgagccagctcctg
caaagcatggacgtcctgcatcggacatactcggcaccagctatcaacgccatccagggt
ggatcttttgaaagtcccaaaaaggaaaaaagatcgcacaggaggtggcggtccagagct
attggcaaagatgctaaaggaacactgcaggtcccgaaacctttttctggcccagtaaga
ctacactcctccaatcctaatttgtcaacactagattttggagaagagaaaaattattct
gatggctctgaaacctcatcagagttttctaaaatgcaagaagatctgtgtcatattgcc
cataaagtttacttcactttaaggtcagcttttaatatcatgtcagcggagagagagaaa
ctgaagcagctgatggagcaggatgcctcctcctccccgtctgctcaggtcattggtctg
aagaacgccctgtcatccgccctagcacaaaacacagatcttaaagaacgcttacgcaga
atccatgccgagtctctgctcctcgactcccccgctgtcgccaagtcgggtgacaatctg
gcagaggaaaactccagagatgaaaaccgagctctagttcatcagctttctaatgaaagt
agactctccatcactgactccctttctgagttttttgatgctcaggaagttctgttatct
ccaagctcttcagaaaacgagatttctgatgatgactcatatgtcagtgacataagtgat
aatctttccttagataatctcagtaatgatttagataatgagagacagaccttggggcct
gtccttgatagtggtcgggaagcgaagtcccggagaagaacgtgcctgccggcgccctgc
ccgagcagcagtaacatcagcctgtggaacatcctgaggaacaacatcgggaaggacctg
tccaaggtggccatgccggtggagctgaacgagcccctgaacacgctgcagaggctctgc
gaggagctggagtacagcgagctcctggacaaggccgcgcagattcccagccccctggaa
aggatggtatatgtggcagcctttgccatatcagcgtatgcatctagctactaccgagct
ggaagcaagccatttaatccggttcttggagaaacatatgaatgtattcgggaggacaag
ggcttccagtttttttcagaacaggtcagccaccatccgcctatctctgcgtgtcatgct
gagtctagaaattttgttttctggcaagatgtgagatggaaaaacaaattctggggcaaa
tccatggaaattgttccaattggcacaacccatgtgactctgccagtttttggggatcat
tttgagtggaacaaagtgacctcttgcatccataacatcttaagcgggcagaggtggatt
gagcactatggagagattgtcatcaagaacctgcatgatgattcctgctactgcaaagtg
aattttataaaggcaaaatactggagcactaatgcccatgagattgaaggcacagtgttt
gacaggagtggaaaagcggttcatcggctgtttgggaaatggcatgaaagcatctactgt
ggcggcggctcctcttctgcctgtgtatggagagcaaatcctatgccgaaaggctacgag
caatactatagcttcacacagtttgcgctggaattaaatgaaatggatccatcatcaaag
tctttattgccacctactgacactcgatttaggccagaccagaggtttctagaggaaggg
aacttagaagaagctgaaatacaaaagcagaggattgaacaactgcagagagaaaggcgg
cgggtcttagaagaaaatcatgtggagcaccagcctcggtttttcaggaaatccgacgat
gactcttgggtgagcaacggcacctatttggaacttagaaaagatcttggtttttccaaa
ctggaccatcctgtcttatggtga

DBGET integrated database retrieval system