KEGG   Homo sapiens (human): 26036Help
Entry
26036             CDS       T01001                                 

Gene name
ZNF451, COASTER, dJ417I1.1
Definition
(RefSeq) zinc finger protein 451
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PIN_11 zf-C2H2_4 PIN7 zf-C2H2_2 zf-C2H2_jaz zf-C2H2
Motif
Other DBs
NCBI-GeneID: 26036
NCBI-ProteinID: NP_001026794
OMIM: 615708
HGNC: 21091
Ensembl: ENSG00000112200
Vega: OTTHUMG00000014916
Pharos: Q9Y4E5(Tbio)
UniProt: Q9Y4E5 Q96JY2
Structure
PDB: 

Position
6p12.1
AA seq 1061 aa AA seqDB search
MGDPGSEIIESVPPAGPEASESTTDENEDDIQFVSEGPLRPVLEYIDLVSSDDEEPSTSY
TDENIKRKDHIDYQKDKVALTLARLARHVEVEKQQKEEKNRAFREKIDFQHAHGLQELEF
IRGHSDTEAARLCVDQWLKMPGLKTGTINCGTKSSFRRGGHTWVSGKPILCPIMHCNKEF
DNGHLLLGHLKRFDHSPCDPTITLHGPFFSSFACVVCYKKFVTQQQYRDHLFDKEATDDG
HNNNLLPQIIQCFACPNCFLLFSRKEECSKHMSGKNHFHQSFKLGDNKGIAHPISFPSFA
KKLLISLCKDVPFQVKCVACHKTLRSHMELTAHFRVHCRNAGPVAVAEKSITQVAEKFIL
RGYCPDCNQVFVDETSTQNHKQNSGHKVRVINSVEESVLLYCHSSEGNKDPSSDLHLLLD
QSKFSSLKRTMSIKESSSLECIAIPKKKMNLKDKSHEGVACVQKEKSVVKTWFCECNQRF
PSEDAVEKHVFSANTMGYKCVVCGKVCDDSGVIRLHMSRIHGGAHLNNFLFWCRTCKKEL
TRKDTIMAHVTEFHNGHRYFYEMDEVEGETLPSSSTTLDNLTANKPSSAITVIDHSPANS
SPRGKWQCRICEDMFDSQEYVKQHCMSLASHKFHRYSCAHCRKPFHKIETLYRHCQDEHD
NEIKIKYFCGLCDLIFNVEEAFLSHYEEHHSIDYVFVSEKTETSIKTEDDFPVIETSNQL
TCGCRESYICKVNRKEDYSRCLQIMLDKGKLWFRCSLCSATAQNLTDMNTHIHQVHKEKS
DEEEQQYVIKCGTCTKAFHDPESAQQHFHRKHCFLQKPSVAHFGSEKSNLYKFTASASHT
ERKLKQAINYSKSLDMEKGVENDLSYQNIEEEIVELPDLDYLRTMTHIVFVDFDNWSNFF
GHLPGHLNQGTFIWGFQGGNTNWKPPLNCKIYNYLNRIGCFFLHPRCSKRKDAADFAICM
HAGRLDEQLPKQIPFTILSGDQGFLELENQFKKTQRPAHILNPHHLEGDMMCALLNSISD
TTKECDSDDNMGAKNTSIGEEFISTEDVELEEAIRRSLEEM
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgggagacccggggtcggagataatagaatctgtccctccagctggccctgaggcatct
gagtcaacaacggatgaaaatgaagacgacattcagtttgtcagtgaaggaccattacga
cctgttcttgaatacattgatctggtcagcagtgatgatgaagagcctagcacctcttat
actgatgagaatattaaacgtaaagaccatattgattatcagaaggataaagttgcttta
actctggctcgtctagcccgccatgttgaagtggagaaacagcagaaagaagagaagaat
agagcattcagagaaaaaattgattttcagcatgctcatgggttacaagaattggaattt
attcgaggacattctgatacagaagcagcaagactgtgtgtggaccagtggctaaaaatg
ccaggactcaaaacaggcacaattaattgtggaacaaaaagttcattccgaagaggaggc
cacacgtgggtgtctgggaaaccaattttatgtcctataatgcactgtaacaaggagttt
gacaatgggcaccttctcttaggacatttgaaaaggttcgatcactctccatgtgatcca
acaattacactacatggacctttcttcagctcctttgcttgtgtagtatgttataaaaaa
tttgttactcaacaacaatatagagatcacctttttgataaggaagccacagatgatgga
cataacaacaaccttcttcctcagattattcagtgttttgcatgtccaaattgcttcctt
ctttttagcagaaaggaggagtgttcaaagcatatgtctggaaagaatcatttccatcag
agtttcaaactgggtgataacaaaggaattgcacatccaatatctttcccatcttttgca
aagaaacttttgatctctctgtgcaaagatgttccctttcaagttaagtgtgtggcctgc
cacaagacactgcgttcccacatggagctcactgcccatttcagagttcattgtcgaaat
gctggacctgtagctgtagctgagaagagcattacccaggttgcagagaaattcatatta
agaggttattgtccagattgcaatcaagtctttgtggatgaaaccagcacccaaaatcat
aagcagaattcaggacacaaagtccgagtcattaactcagtggaagaatcagtcttactc
tattgccacagcagcgaagggaacaaggatccttcttctgacttgcatttattgttggat
caatcaaaattttcatcacttaaaagaaccatgtctattaaagaatctagctcactggag
tgcattgccattccaaaaaagaagatgaatttaaaagataaaagccatgaaggtgttgct
tgtgtccagaaagaaaaatcagtagttaaaacctggttctgtgaatgcaatcagcgattc
ccaagtgaagatgcagtagaaaagcatgttttctcagcaaacacaatgggttataaatgt
gtggtctgtggaaaggtatgtgatgattcaggggtcattcgtttacacatgagccggatt
cacggaggggcacatttaaataactttcttttctggtgtcggacatgcaaaaaggagtta
acaaggaaagatactatcatggcacatgtgactgaatttcataatggacacagatatttt
tatgagatggatgaggtagaaggtgaaactttgccatcatcctctacaacattggataat
ttgactgctaacaagccttcatcagctattactgttattgatcattccccggcaaatagt
tctccgaggggtaaatggcaatgccggatttgtgaagatatgtttgattcccaggaatat
gtaaaacagcactgcatgtctttggcaagccacaagtttcatagatacagctgtgctcac
tgcagaaagccttttcataagatagaaacattgtaccgacattgccaagatgagcatgac
aatgagataaagattaaatacttctgtgggctttgtgatcttatctttaatgtggaagaa
gcatttctgagtcattatgaggagcaccacagcatagattatgtatttgtgtcagaaaaa
actgaaacttcaattaaaaccgaagatgattttccagtaatagagaccagtaaccagtta
acttgtggttgccgtgagagttacatctgtaaagtcaacagaaaagaagattatagcaga
tgtctccaaatcatgctggataaaggaaaactgtggtttcgctgcagtttatgttcggca
acagcacagaatttaaccgacatgaacactcatatccatcaagtgcacaaagaaaagagt
gatgaggaggagcagcagtatgtaatcaagtgtggcacctgcaccaaagcatttcatgat
cctgagagtgcacagcagcatttccatagaaaacattgcttcttacagaaacccagtgtg
gctcattttggatctgaaaaatcaaacctgtacaagtttactgctagtgcctcacataca
gagagaaaactgaaacaggcaataaactattcaaaaagtttagacatggagaaaggagtt
gagaatgacctaagctatcagaatatagaggaagaaattgttgagcttccagatttggat
tacctgcgaaccatgactcatatagtctttgtagattttgataactggtcaaactttttt
ggtcatctaccagggcatctaaaccaaggaacatttatttggggctttcaaggaggaaac
accaattggaagcctccgctcaactgtaagatttataactacctgaacaggattggatgc
ttcttccttcatcctcgctgtagtaaaagaaaagatgctgctgattttgccatatgtatg
catgctggccgtctagatgaacaactacccaagcaaattcctttcaccatcctctcagga
gatcaaggttttctggagctagagaatcaatttaagaagactcagaggccagctcatata
ctaaaccctcaccacttagagggagatatgatgtgtgccttgttaaatagcatatctgat
accaccaaagaatgtgacagtgatgataacatgggtgccaaaaatacttcaataggagaa
gaatttatatccacagaagatgtggaattagaagaagctattagaagaagtcttgaggaa
atgtaa

DBGET integrated database retrieval system