KEGG   Homo sapiens (human): 26038Help
Entry
26038             CDS       T01001                                 

Gene name
CHD5, CHD-5
Definition
(RefSeq) chromodomain helicase DNA binding protein 5
  KO
K14435  chromodomain-helicase-DNA-binding protein 5 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    26038 (CHD5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     26038 (CHD5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    26038 (CHD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHDCT2 DUF1086 SNF2_N DUF1087 CHDNT PHD Helicase_C Chromo ResIII HDA2-3 PHD_2 AAA_22
Motif
Other DBs
NCBI-GeneID: 26038
NCBI-ProteinID: NP_056372
OMIM: 610771
HGNC: 16816
Ensembl: ENSG00000116254
Vega: OTTHUMG00000000952
Pharos: Q8TDI0(Tbio)
UniProt: Q8TDI0
Structure
PDB: 

Position
1p36.31
AA seq 1954 aa AA seqDB search
MRGPVGTEEELPRLFAEEMENEDEMSEEEDGGLEAFDDFFPVEPVSLPKKKKPKKLKENK
CKGKRKKKEGSNDELSENEEDLEEKSESEGSDYSPNKKKKKKLKDKKEKKAKRKKKDEDE
DDNDDGCLKEPKSSGQLMAEWGLDDVDYLFSEEDYHTLTNYKAFSQFLRPLIAKKNPKIP
MSKMMTVLGAKWREFSANNPFKGSSAAAAAAAVAAAVETVTISPPLAVSPPQVPQPVPIR
KAKTKEGKGPGVRKKIKGSKDGKKKGKGKKTAGLKFRFGGISNKRKKGSSSEEDEREESD
FDSASIHSASVRSECSAALGKKSKRRRKKKRIDDGDGYETDHQDYCEVCQQGGEIILCDT
CPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEPKDDDDEEEEGGCEEEEDDHMEFCR
VCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEP
PAPFMVGLPGPDVEPSLPPPKPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYR
NYQRKNDMDEPPPFDYGSGDEDGKSEKRKNKDPLYAKMEERFYRYGIKPEWMMIHRILNH
SFDKKGDVHYLIKWKDLPYDQCTWEIDDIDIPYYDNLKQAYWGHRELMLGEDTRLPKRLL
KKGKKLRDDKQEKPPDTPIVDPTVKFDKQPWYIDSTGGTLHPYQLEGLNWLRFSWAQGTD
TILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTY
TGDKESRSVIRENEFSFEDNAIRSGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIE
WACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNN
LEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYY
KFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLV
KSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQ
EAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQN
KKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEEL
FKDDVEGMMSQGQRPVTPIPDVQSSKGGNLAASAKKKHGSTPPGDNKDVEDSSVIHYDDA
AISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVREEDGVEEVEREIIKQEENVDPDYW
EKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDED
EDFEERPEGQSGRRQSRRQLKSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWG
MPPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHV
LTRIGVMSLVRKKVQEFEHVNGKYSTPDLIPEGPEGKKSGEVISSDPNTPVPASPAHLLP
APLGLPDKMEAQLGYMDEKDPGAQKPRQPLEVQALPAALDRVESEDKHESPASKERAREE
RPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIHSRGDSSELRPDDTKAEEKEPIET
QQNGDKEEDDEGKKEDKKGKFKFMFNIADGGFTELHTLWQNEERAAVSSGKIYDIWHRRH
DYWLLAGIVTHGYARWQDIQNDPRYMILNEPFKSEVHKGNYLEMKNKFLARRFKLLEQAL
VIEEQLRRAAYLNMTQDPNHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKV
LNQLEELLSDMKADVTRLPSMLSRIPPVAARLQMSERSILSRLTNRAGDPTIQQGAFGSS
QMYSNNFGPNFRGPGPGGIVNYNQMPLGPYVTDI
NT seq 5865 nt NT seq  +upstreamnt  +downstreamnt
atgcggggcccagtgggcaccgaggaggagctgccgcggctgttcgccgaggagatggag
aatgaggacgagatgtcagaagaagaagatggtggtcttgaagccttcgatgactttttc
cctgtggagcccgtgagccttcctaagaagaagaaacccaagaagctcaaggaaaacaag
tgtaaagggaagcggaagaagaaagaggggagcaatgatgagctatcagagaatgaagag
gatctggaagagaagtcggagagtgaaggcagtgactactccccgaataaaaagaagaag
aagaaactcaaggacaagaaggagaaaaaagccaagcgaaaaaagaaggatgaggatgag
gatgataatgatgatggatgcttaaaggagcccaagtcctcggggcagctcatggccgag
tggggcctggacgacgtggactacctgttctcggaggaggattaccacacgctgaccaac
tacaaggccttcagccagttcctcaggccactcattgccaagaagaacccgaagatcccc
atgtccaaaatgatgaccgtcctgggtgccaagtggcgggagttcagcgccaacaacccc
ttcaagggcagctccgcggcagcagcggcggcggcggtggctgcggctgtagagacggtc
accatctcccctccgctagccgtcagccccccgcaggtgccccagcctgtgcctatccgc
aaggccaagaccaaggagggcaaagggcctggagtgaggaagaagatcaaaggctccaaa
gatgggaagaaaaagggcaaagggaaaaagacggccgggctcaagttccgcttcgggggg
atcagcaacaagaggaagaaaggctcctcgagtgaagaagatgagagggaggagtcggac
ttcgacagcgccagcatccacagtgcctccgtgcgctccgaatgctctgcagccctgggc
aagaagagcaagaggaggcgcaagaagaagaggattgatgatggtgacggctatgagaca
gaccaccaggattactgtgaggtgtgccagcagggtggggagatcatcctgtgcgacacc
tgcccgagggcctaccatctcgtatgcctggacccagagctggagaaggctcccgagggc
aagtggagctgcccccactgtgagaaggaggggatccagtgggagccgaaggacgacgac
gatgaagaggaggagggcggctgcgaggaggaggaggacgaccacatggagttctgccgc
gtgtgcaaggacgggggcgagctgctctgctgcgacgcctgcccctcctcctaccacctg
cattgcctcaacccgccgctgcccgagatcccaaacggtgaatggctctgcccgcgctgt
acttgccccccactgaagggcaaagtccagcggattctacactggaggtggacggagccc
cctgcccccttcatggtggggctgccggggcctgacgtggagcccagcctccctccacct
aagcccctggagggcatccctgagagagagttctttgtcaagtgggcagggctgtcctac
tggcattgctcctgggtgaaggagctacagctggagctgtaccacacggtgatgtatcgc
aactaccaaagaaagaacgacatggatgagccgcccccctttgactacggctctggggat
gaagacggcaagagcgagaagaggaagaacaaggaccccctctatgccaagatggaggag
cgcttctaccgctatggcatcaagccagagtggatgatgattcaccgaatcctgaaccat
agctttgacaagaagggggatgtgcactacctgatcaagtggaaagacctgccctacgac
cagtgcacctgggagatcgatgacatcgacatcccctactacgacaacctcaagcaggcc
tactggggccacagggagctgatgctgggagaagacaccaggctgcccaagaggctgctc
aagaagggcaagaagctgagggacgacaagcaggagaagccgccggacacgcccattgtg
gaccccacggtcaagttcgacaagcagccatggtacatcgactccacaggcggcacactg
cacccgtaccagctggagggcctcaactggctgcgcttctcttgggcccagggcactgac
accatcctggccgatgagatgggtctgggcaagacggtgcagaccatcgtgttcctttac
tccctctacaaggagggccactccaaagggccctacctggttagcgcgcccctctccacc
atcatcaactgggaacgcgagtttgagatgtgggcgcccgacttctacgtggtcacctac
acgggggacaaggagagccgctcggtgattcgggagaacgagttttcctttgaggacaac
gccattcggagtgggaagaaggtattccgtatgaagaaagaagtgcagatcaaattccac
gtgctgctcacctcctatgagctcatcaccattgaccaggccatcctgggctccatcgag
tgggcctgcctggtggtagatgaggcccaccgcctcaagaacaaccagtccaagtttttt
agggtcttaaacagctacaagattgattacaagctgctgctgacagggaccccccttcag
aacaacctggaggagctgttccatctcctcaacttcctgactccagagaggttcaacaac
ctggagggcttcctggaggagtttgctgacatctccaaggaagaccagatcaagaagctg
catgacctgctggggccgcacatgctcaggcggctcaaggctgacgtgttcaagaacatg
ccggccaagaccgagctcattgtccgggtggagctgagccagatgcagaagaagtactac
aagttcatcctcacacggaactttgaggcactgaactccaaggggggcgggaaccaagta
tcgctgctcaacatcatgatggacctgaaaaagtgctgcaaccacccctacctcttccct
gtggctgccgtggaggcccctgtcttgcccaatggctcctacgatggaagctccctggtc
aagtcttcagggaagctcatgctgctacagaagatgctgaagaaactgcgggatgagggg
caccgtgtgctcatcttctcccagatgaccaagatgctggacctcctggaggacttcctg
gagtacgaaggctacaagtatgagcggattgatggtggcatcaccgggggcctccggcag
gaggcaatcgacagattcaatgcccccggggcccagcagttctgcttcctcctctcaacc
cgggcaggtggtctgggcatcaacctggccacggcggacactgtcatcatctacgactcg
gactggaacccgcacaatgacatccaggccttcagccgcgcccaccgcatcggccagaac
aagaaggtgatgatctaccgcttcgtgactcgggcctcggtggaggagcgcatcacgcag
gtggccaagcgcaagatgatgctcacccacctggtggtgcggcccggcctcggctccaag
tcggggtccatgaccaagcaggagctggacgacatcctcaagttcggcacggaggaactc
ttcaaggacgacgtggagggcatgatgtctcagggccagaggccggtcacacccatccct
gatgtccagtcctccaaaggggggaacttggccgccagtgcaaagaagaagcacggtagc
accccgccaggtgacaacaaggacgtggaggacagcagtgtgatccactatgacgatgcg
gccatctccaagctgctggaccggaaccaggacgctacagatgacacggagctacagaac
atgaacgagtacctgagctccttcaaggtggcgcagtacgtggtgcgcgaggaggacggc
gtggaggaggtggagcgggaaatcatcaagcaggaggagaacgtggaccccgactactgg
gagaagctgctgcggcaccactatgagcagcagcaggaggacctggcccgcaacctgggc
aagggcaagcgcatccgcaagcaggtcaactacaacgatgcctcccaggaggaccaggag
tggcaggatgagctctctgataaccagtcagaatattccattggctctgaggatgaggat
gaggactttgaagagaggccggaagggcagagtggacgacgacaatcccggaggcagctg
aagagtgacagggacaagcccctgcccccgcttctcgcccgagttggtggcaacatcgag
gtgctgggcttcaatgcccgacagcggaaggcctttctgaacgccatcatgcgctggggc
atgcccccgcaggacgccttcaactcccactggctggtgcgggaccttcgagggaagagc
gagaaggagtttagagcctatgtgtccctcttcatgcggcacctgtgtgagccgggggcg
gatggtgcagagaccttcgcagacggcgtgccccgggagggcctctccaggcagcacgtg
ctgacccgcatcggggtcatgtcactagttaggaagaaggttcaggagtttgagcatgtc
aacgggaagtacagcaccccagacttgatccctgaggggcccgaggggaagaagtcgggc
gaggtgatctcctcggaccccaacacaccagtgcccgccagccctgcccacctcctgcca
gccccgctgggcctgccagacaaaatggaagcccagctgggctacatggatgagaaagac
cccggggcacagaagccaaggcagcccctggaagtccaggcccttccagccgccttggat
agagtggagagtgaggacaagcacgagagcccagccagcaaggagagagcccgagaggag
cggccagaggagacggagaaggccccgccctccccggagcagctgccgagagaggaggtg
cttcctgagaaggagaagatcctggacaagctggagctgagcttgatccacagcagaggg
gacagttccgaactcaggccagatgacaccaaggctgaggagaaggagcccattgaaaca
cagcaaaatggtgacaaagaggaagatgacgaggggaagaaggaggacaagaaggggaaa
ttcaagttcatgttcaacatcgcggacgggggcttcacggagttgcacacgctgtggcag
aacgaggagcgggctgctgtatcctctgggaaaatctacgacatctggcaccggcgccat
gactactggctgctggcgggcatcgtgacgcacggctacgcccgctggcaggacatccag
aatgacccacggtacatgatcctcaacgagcccttcaagtctgaggtccacaagggcaac
tacctggagatgaagaacaagttcctggcccgcaggtttaagctgctggagcaggcgttg
gtcattgaggagcagctccggagggccgcgtacctgaacatgacgcaggaccccaaccac
cccgccatggccctcaacgcccgcctggctgaagtggagtgcctcgccgagagccaccag
cacctgtccaaggagtcccttgctgggaacaagcctgccaatgccgtcctgcacaaggtc
ctgaaccagctggaggagctgctgagcgacatgaaggccgacgtgacccggctgccatcc
atgctgtcccgcatccccccggtggccgcccggctgcagatgtcggagcgcagcatcctg
agccgcctgaccaaccgcgccggggaccccaccatccagcagggcgctttcggctcctcc
cagatgtacagcaacaactttgggcccaacttccggggccctggaccgggagggattgtc
aactacaaccagatgcccctggggccctatgtgaccgatatctag

DBGET integrated database retrieval system