KEGG   Homo sapiens (human): 260429Help
Entry
260429            CDS       T01001                                 

Gene name
PRSS33, EOS
Definition
(RefSeq) serine protease 33
  KO
K09629  serine protease 33 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    260429 (PRSS33)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     260429 (PRSS33)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   260429 (PRSS33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 260429
NCBI-ProteinID: NP_690851
OMIM: 613797
HGNC: 30405
Ensembl: ENSG00000103355
Vega: OTTHUMG00000177360
Pharos: Q8NF86(Tdark)
UniProt: Q8NF86
Position
16p13.3
AA seq 280 aa AA seqDB search
MRGVSCLQVLLLLVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAH
VCGGSLIAPQWVLTAAHCFPRRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSE
DGARGDLALLQLRRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPL
QGVRVPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQS
GSWVLVGVVSWGKGCALPNRPGVYTSVATYSPWIQARVSF
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagaggggtttcctgtctccaggtcctgctccttctggtgctgggagctgctgggact
cagggaaggaagtctgcagcctgcgggcagccccgcatgtccagtcggatcgttgggggc
cgggatggccgggacggagagtggccgtggcaggcgagcatccagcatcgtggggcacac
gtgtgcggggggtcgctcatcgccccccagtgggtgctgacagcggcgcactgcttcccc
aggagggcactgccagctgagtaccgcgtgcgcctgggggcgctgcgtctgggctccacc
tcgccccgcacgctctcggtgcccgtgcgacgggtgctgctgcccccggactactccgag
gacggggcccgcggcgacctggcactgctgcagctgcgtcgcccggtgcccctgagcgct
cgcgtccaacccgtctgcctgcccgtgcccggcgcccgcccgccgcccggcacaccatgc
cgggtcaccggctggggcagcctccgcccaggagtgcccctcccagagtggcgaccgcta
caaggagtaagggtgccgctgctggactcgcgcacctgcgacggcctctaccacgtgggc
gcggacgtgccccaggctgagcgcattgtgctgcctgggagtctgtgtgccggctacccc
cagggccacaaggacgcctgccagggtgattctgggggacctctgacctgcctgcagtct
gggagctgggtcctggtgggcgtggtgagctggggcaagggttgtgccctgcccaaccgt
ccaggggtctacaccagtgtggccacatatagcccctggattcaggctcgcgtcagcttc
taa

DBGET integrated database retrieval system