KEGG   Homo sapiens (human): 26043Help
Entry
26043             CDS       T01001                                 

Gene name
UBXN7, UBXD7
Definition
(RefSeq) UBX domain protein 7
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: UBX Thioredoxin_7 UBA_4 UIM Thioredox_DsbH Thioredoxin_2
Motif
Other DBs
NCBI-GeneID: 26043
NCBI-ProteinID: NP_056377
OMIM: 616379
HGNC: 29119
Ensembl: ENSG00000163960
Vega: OTTHUMG00000155639
Pharos: O94888(Tbio)
UniProt: O94888
Structure
PDB: 

Position
3q29
AA seq 489 aa AA seqDB search
MAAHGGSAASSALKGLIQQFTTITGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPS
TSSASVSTVRPHTEEEVRAPIPQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIR
QEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFAC
QCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLV
EWHQLDVSSFLDQVTGFLGEHGQLDGLSSSPPKKCARSESLIDASEDSQLEAAIRASLQE
THFDSTQTKQDSRSDEESESELFSGSEEFISVCGSDEEEEVENLAKSRKSPHKDLGHRKE
ENRRPLTEPPVRTDPGTATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRYP
DGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQ
ETVFVQERN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccacgggggctccgcggcgtcctcggcgctgaaggggttaattcaacagttc
accaccattaccggtgcaagtgaaagtgtaggaaaacatatgcttgaagcgtgcaacaat
aatctggaaatggcagtcactatgtttttggatggtggaggaatcgctgaagagcccagt
accagttcagcaagtgtctctactgtcagaccacacacagaagaagaagttcgtgcccca
attcctcaaaagcaggaaatactggtggaaccagaaccattatttggtgctcctaaaaga
cgacggcctgcacgttcaatttttgatggtttccgggattttcagactgaaactattcgg
caagaacaagaattaagaaatggaggagctatcgataagaaattaactacccttgcagat
ctattccggccacccattgatttgatgcataaaggcagctttgaaacagccaaagagtgt
ggccagatgcaaaataagtggctgatgataaacattcaaaatgttcaagactttgcatgt
cagtgcctcaaccgcgatgtgtggagcaacgaagctgtgaagaatattatccgggaacat
ttcattttctggcaggtttatcatgacagtgaggaaggtcagagatacatacagttttat
aagttaggggatttcccctatgtttccatattggacccacggacaggtcagaagctagta
gaatggcaccagttagatgtatcttctttcttggaccaagtgacgggatttctgggtgaa
catggacaactggatggactttctagcagtccccccaaaaaatgtgcccgttcagagagc
cttatagatgcaagtgaagacagccagctagaagctgccatcagagcctccttacaagaa
acacattttgattcaacacagacaaaacaggatagccgctcagatgaagaatctgaatct
gaacttttttctggcagtgaggagttcatatccgtttgtggctctgatgaagaagaagag
gtagagaatcttgccaagtccagaaagtctccccacaaagatttggggcatagaaaagag
gagaatagaaggccgctgactgagccaccagtcagaactgatcctggaacagccacaaac
caccaaggattgccagctgtggattcagagatactggagatgccacctgaaaaagcagat
ggagtagtggaggggatagatgtaaatggaccaaaagcacagctgatgttgcggtatcca
gatggaaaaagggaacagatcactcttccagagcaagctaaactgctagctttggtgaag
cacgtgcagtctaaaggatacccaaatgaacgttttgaacttctcaccaactttcctcga
aggaaattatctcatctggactatgatattacattgcaagaggcaggcctttgtcctcaa
gagactgtctttgtacaggaaagaaattaa

DBGET integrated database retrieval system