KEGG   Homo sapiens (human): 260434
Entry
260434            CDS       T01001                                 

Gene name
PYDC1, ASC2, POP1, PYC1, cPOP1
Definition
(RefSeq) pyrin domain containing 1
  KO
K12802  pyrin domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    260434 (PYDC1)
SSDB
Motif
Pfam: PYRIN
Other DBs
NCBI-GeneID: 260434
NCBI-ProteinID: NP_690865
OMIM: 615700
HGNC: 30261
Ensembl: ENSG00000169900
Vega: OTTHUMG00000132407
Pharos: Q8WXC3(Tbio)
UniProt: Q8WXC3
Structure
PDB: 
4QOB 2HM2

Position
16p11.2
AA seq 89 aa
MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASY
YEDYAAELVVAVLRDMRMLEEAARLQRAA
NT seq 270 nt   +upstreamnt  +downstreamnt
atgggaacgaagcgcgaggccatcctgaaggtgctggagaacctgacaccggaggagctc
aagaagttcaagatgaagctggggacggtgccgctgcgcgagggctttgagcgcatcccg
cggggcgcgctcgggcagctagatatcgtggacctcaccgacaagctggtcgcctcctac
tacgaggactacgcagccgagctcgtcgtggccgtgctgcgcgacatgcgcatgttggag
gaggccgcacggctgcagcgggctgcgtga

DBGET integrated database retrieval system