KEGG   Homo sapiens (human): 260436
Entry
260436            CDS       T01001                                 
Symbol
FDCSP, C4orf7, FDC-SP
Name
(RefSeq) follicular dendritic cell secreted protein
  KO
K25534  follicular dendritic cell secreted peptide
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    260436 (FDCSP)
SSDB
Motif
Pfam: FDC-SP LPAM_1
Other DBs
NCBI-GeneID: 260436
NCBI-ProteinID: NP_694542
OMIM: 607241
HGNC: 19215
Ensembl: ENSG00000181617
Pharos: Q8NFU4(Tbio)
UniProt: Q8NFU4 Q540F3
Position
4:70226124..70235252
AA seq 85 aa
MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPR
FPWFRRNFPIPIPESAPTTPLPSEK
NT seq 258 nt   +upstreamnt  +downstreamnt
atgaagaaagttctcctcctgatcacagccatcttggcagtggctgttggtttcccagtc
tctcaagaccaggaacgagaaaaaagaagtatcagtgacagcgatgaattagcttcaggg
ttttttgtgttcccttacccatatccatttcgcccacttccaccaattccatttccaaga
tttccatggtttagacgtaattttcctattccaatacctgaatctgcccctacaactccc
cttcctagcgaaaagtaa

DBGET integrated database retrieval system