KEGG   Homo sapiens (human): 26045
Entry
26045             CDS       T01001                                 

Gene name
LRRTM2
Definition
(RefSeq) leucine rich repeat transmembrane neuronal 2
  KO
K16665  leucine-rich repeat transmembrane neuronal protein 1/2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    26045 (LRRTM2)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9
Other DBs
NCBI-GeneID: 26045
NCBI-ProteinID: NP_056379
OMIM: 610868
HGNC: 19409
Ensembl: ENSG00000146006
Vega: OTTHUMG00000163535
Pharos: O43300(Tbio)
UniProt: O43300
Structure
PDB: 
5Z8X 5Z8Y

Position
5q31.2
AA seq 516 aa
MGLHFKWPLGAPMLAAIYAMSMVLKMLPALGMACPPKCRCEKLLFYCDSQGFHSVPNATD
KGSLGLSLRHNHITELERDQFASFSQLTWLHLDHNQISTVKEDAFQGLYKLKELILSSNK
IFYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSLRTIPVRLFWDC
RSLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINFAHFLRLSSLHTLFLQWNK
ISNLTCGMEWTWGTLEKLDLTGNEIKAIDLTVFETMPNLKILLMDNNKLNSLDSKILNSL
RSLTTVGLSGNLWECSARICALASWLGSFQGRWEHSILCHSPDHTQGEDILDAVHGFQLC
WNLSTTVTVMATTYRDPTTEYTKRISSSSYHVGDKEIPTTAGIAVTTEEHFPEPDNAIFT
QRVITGTMALLFSFFFIIFIVFISRKCCPPTLRRIRQCSMVQNHRQLRSQTRLHMSNMSD
QGPYNEYEPTHEGPFIIINGYGQCKCQQLPYKECEV
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgggcttacatttcaagtggccattaggggcccctatgctggcagcaatatatgcaatg
agtatggttttaaaaatgctgcctgccctgggtatggcgtgtccacccaaatgccgctgc
gagaagctgctcttctactgcgactctcagggcttccactcagtgccaaacgccacagac
aagggctctctgggcctgtccctgaggcacaatcacatcacagagctcgaaagagatcaa
tttgccagcttcagtcaacttacttggctccacttagatcacaatcaaatttcaacagta
aaagaagatgcttttcaaggactatataaacttaaggaattaatcttaagttccaacaaa
atattttacttgccaaacacaacttttacccaactgattaacctgcaaaatttggacctg
tcttttaatcagctgtcatctctgcacccagagctcttctatggccttcggaagctgcag
accttgcatttacgttccaactccctgcggactatcccagtacgcctgttctgggactgt
cgtagtctggagtttctggatttgagcacaaatcgtttgcgaagtttggctcgcaatgga
tttgcaggattaattaaactgagagagcttcacctagagcacaaccagctgacgaagatt
aattttgctcatttcctacggctaagcagtctgcacacgctcttcttacaatggaacaaa
atcagcaacttgacatgtgggatggagtggacctggggcactttagaaaagctagacctg
actggaaatgaaatcaaagccatcgacttgacagtgtttgaaacgatgcccaatcttaaa
atactcctcatggataacaacaagttaaacagccttgattccaagatcttaaactccctg
agatccctcacaaccgttggtctctctggcaatctgtgggaatgcagcgcccgaatatgt
gctctggcctcctggctgggcagtttccaaggtcggtgggaacactccatcctatgccac
agtcctgaccacacccaaggagaggatattctagatgcagtccatggatttcagctctgc
tggaatttgtcaaccactgtcactgtcatggctacaacttatagagatccaaccactgaa
tatacaaaaagaataagctcatcaagttaccatgtgggagacaaagaaatcccaactact
gcaggcatagcagttactaccgaggaacactttcctgaaccagacaatgccatcttcact
cagcgggtaattacgggaacaatggctttattgttttctttcttttttattatttttata
gtgttcatctccaggaagtgctgccctcccactttaagaagaattaggcagtgctcaatg
gttcagaaccacaggcagctccgatcccaaacacgactccatatgtcaaacatgtcagac
caaggaccgtataatgaatatgaacccacccatgaaggacccttcatcatcattaatggt
tatggacagtgcaagtgtcagcagctgccatacaaagaatgtgaagtataa

DBGET integrated database retrieval system