KEGG   Homo sapiens (human): 26046Help
Entry
26046             CDS       T01001                                 

Gene name
LTN1, C21orf10, C21orf98, RNF160, ZNF294
Definition
(RefSeq) listerin E3 ubiquitin protein ligase 1
  KO
K22377  E3 ubiquitin-protein ligase listerin [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    26046 (LTN1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     26046 (LTN1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    26046 (LTN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_2 FANCL_C zf-ANAPC11 zf-rbx1 RINGv zf-C3HC4 HipN zf-RING-like zf-C3HC4_2
Motif
Other DBs
NCBI-GeneID: 26046
NCBI-ProteinID: NP_001307695
OMIM: 613083
HGNC: 13082
Ensembl: ENSG00000198862
Vega: OTTHUMG00000078803
Pharos: O94822(Tbio)
UniProt: O94822
Position
21q21.3
AA seq 1752 aa AA seqDB search
MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPAIQGAEEIDSL
VDSDFRMVLRKLSKKDVTTKLKAMQEFGTMCTERDTETVKGVLPYWPRIFCKISLDHDRR
VREATQQAFEKLILKVKKQLAPYLKSLMGYWLMAQCDTYTPAAFAAKDAFEAAFPPSKQP
EAIAFCKDEITSVLQDHLIKETPDTLSDPQTVPEEEREAKFYRVVTCSLLALKRLLCLLP
DNELDSLEEKFKSLLSQNKFWKYGKHSVPQIRSAYFELVSALCQRIPQLMKEEASKVSPS
VLLSIDDSDPIVCPALWEAVLYTLTTIEDCWLHVNAKKSVFPKLSTVIREGGRGLATVIY
PYLLPFISKLPQSITNPKLDFFKNFLTSLVAGLSTERTKTSSLESSAVISAFFECLRFIM
QQNLGEEEIEQMLVNDQLIPFIDAVLKDPGLQHGQLFNHLAETLSSWEAKADTEKDEKTA
HNLENVLIHFWERLSEICVAKISEPEADVESVLGVSNLLQVLQKPKSSLKSSKKKNGKVR
FADEILESNKENEKCVSSEGEKIEGWELTTEPSLTHNSSGLLSPLRKKPLEDLVCKLADI
SINYVNERKSEQHLRFLSTLLDSFSSSRVFKMLLGDEKQSIVQAKPLEIAKLVQKNPAVQ
FLYQKLIGWLNEDQRKDFGFLVDILYSALRCCDNDMERKKVLDDLTKACPSSDKHALVTP
WLKGDILGEKLVNLADCLCNEDLESRVSSESHFSERWTLLSLVLSQHVKNDYLIGDVYVE
RIIVRLHETLFKTKKLSEAESSDSSVSFICDVAYNYFSSAKGCLLMPSSEDLLLTLFQLC
AQSKEKTHLPDFLICKLKNTWLSGVNLLVHQTDSSYKESTFLHLSALWLKNQVQASSLDI
NSLQVLLSAVDDLLNTLLESEDSYLMGVYIGSVMPNDSEWEKMRQSLPMQWLHRPLLEGR
LSLNYECFKTDFKEQDIKTLPSHLCTSALLSKMVLIALRKETVLENNELEKIIAELLYSL
QWCEELDNPPIFLIGFCEILQKMNITYDNLRVLGNTSGLLQLLFNRSREHGTLWSLIIAK
LILSRSISSDEVKPHYKRKESFFPLTEGNLHTIQSLCPFLSKEEKKEFSAQCIPALLGWT
KKDLCSTNGGFGHLAIFNSCLQTKSIDDGELLHGILKIIISWKKEHEDIFLFSCNLSEAS
PEVLGVNIEIIRFLSLFLKYCSSPLAESEWDFIMCSMLAWLETTSENQALYSIPLVQLFA
CVSCDLACDLSAFFDSTTLDTIGNLPVNLISEWKEFFSQGIHSLLLPILVTVTGENKDVS
ETSFQNAMLKPMCETLTYISKEQLLSHKLPARLVADQKTNLPEYLQTLLNTLAPLLLFRA
RPVQIAVYHMLYKLMPELPQYDQDNLKSYGDEEEEPALSPPAALMSLLSIQEDLLENVLG
CIPVGQIVTIKPLSEDFCYVLGYLLTWKLILTFFKAASSQLRALYSMYLRKTKSLNKLLY
HLFRLMPENPTYAETAVEVPNKDPKTFFTEELQLSIRETTMLPYHIPHLACSVYHMTLKD
LPAMVRLWWNSSEKRVFNIVDRFTSKYVSSVLSFQEISSVQTSTQLFNGMTVKARATTRE
VMATYTIEDIVIELIIQLPSNYPLGSIIVESGKRVGVAVQQWRNWMLQLSTYLTHQNGSI
MEGLALWKNNVDKRFEGVEDCMICFSVIHGFNYSLPKKACRTCKKKFHSACLYKWFTSSN
KSTCPLCRETFF
NT seq 5259 nt NT seq  +upstreamnt  +downstreamnt
atgggcgggaagaacaagcagcgaactaaagggaacctgaggccttcaaacagtggccga
gctgcagaactccttgccaaagaacagggaacagtgcctggatttattggttttggaaca
tctcagagtgacctaggctatgttcctgctattcaaggagctgaagaaattgacagtctt
gtagattctgatttccgaatggtgctgcggaaactttcaaagaaagatgtcaccacaaaa
ttaaaagctatgcaggaatttggaaccatgtgtacagagagagacacagaaactgtgaaa
ggagttcttccatattggccaagaattttttgcaaaatttcacttgatcatgaccgtcgc
gtccgagaagccacacaacaagcttttgaaaaacttatccttaaagtaaagaaacagttg
gctccctacttaaaaagtttaatgggatattggctaatggctcagtgtgatacttacaca
ccagctgcgtttgcagcaaaagatgcatttgaagcggcttttcctccaagcaagcaacct
gaagccatagcattttgtaaggatgaaattacaagtgtgctgcaggatcatcttataaaa
gaaacacctgatacactcagtgacccgcaaactgttccagaggaagaaagagaagctaaa
ttctaccgggttgtaacttgttccttattggcattaaagagattactttgccttttacct
gataatgagcttgattctctggaggagaaatttaagtctcttttatcacagaataagttt
tggaagtatggaaaacacagtgtacctcagattcgctcagcttattttgagttagtctct
gcattgtgccagcgcattccacagttgatgaaagaggaagcatccaaagtgagcccatca
gttctacttagcattgatgacagtgacccaattgtctgcccagctctctgggaagctgta
ctctatacacttacaactattgaggactgttggcttcatgtaaatgcaaaaaagagtgtg
tttcccaagctatcaactgtgattcgtgaaggtggtcggggtctagctactgtcatatat
ccttaccttctgccattcatcagcaagctccctcagtccatcacaaatccaaagttggat
ttcttcaaaaatttcctcacgtctctagttgctgggctgtcaacagagagaactaaaacc
agctctttagagtcctcggcagtaatatctgctttttttgaatgcttacgttttataatg
cagcaaaacttaggtgaggaagagattgaacagatgctcgtcaatgatcagttgatccct
tttattgatgcagttctcaaagacccaggattgcaacatgggcagctatttaaccattta
gcagaaactctaagttcctgggaagccaaagcagacacggaaaaagatgaaaaaacagct
cacaacttggagaacgtactgatacatttctgggaaagactgtcagagatctgtgttgcg
aaaatcagtgagccagaagctgatgttgagtccgttttgggtgtatctaacctattacag
gtgcttcagaagccgaagagctcattgaagtcaagtaaaaaaaaaaatggtaaggttaga
tttgctgatgagatacttgaaagcaataaagagaatgaaaaatgtgtatcttcagaagga
gagaagattgaaggctgggaattaacaactgaaccttctctcactcataattcttcaggc
cttttgtctcctctaaggaaaaaacctttggaagacttagtctgtaaactcgcagatata
agtattaattatgtcaatgaacgaaagtcagagcaacatctaaggtttctttctactctg
cttgactccttttcttcaagccgagtatttaaaatgctacttggtgatgaaaaacagagt
attgtccaagccaaacctcttgaaatagccaagcttgtacaaaaaaatcctgcggtgcag
tttttataccagaaactgataggttggctaaatgaagatcaaaggaaggattttggtttc
ctggtggacattttgtacagtgctctccggtgctgtgacaatgatatggaaagaaaaaaa
gtcttggatgatctaaccaaggcatgtcctagttcagataaacatgctttagtaactcct
tggctcaaaggcgatatccttggtgagaaattggtcaacttggcagattgtctttgtaat
gaggacttggaatccagggtatcttcagaatctcacttctcagaaagatggactcttcta
agcttggtattatcccaacatgttaaaaatgattacttgattggagacgtatatgttgaa
agaatcattgttagacttcatgaaactttattcaaaacaaagaaattatcagaagctgaa
agcagtgactcatcagtgtcttttatctgtgatgtggcctataactatttcagctcagcg
aaaggatgcttgctaatgccatcatctgaagatttattattaactctctttcagttatgt
gctcagagcaaagaaaaaacacatttgccagattttcttatctgtaaactgaaaaatact
tggctctctggtgtaaatttattggttcatcaaactgacagttcatataaagagagtacc
ttcctacatttgtctgctctgtggctgaagaaccaagttcaggcttcatctttggatatc
aacagtctccaagtcctcttgtctgctgttgatgatttgctaaatacacttctagagagt
gaagattcttatcttatgggagtttatattggaagtgtaatgccgaacgacagtgaatgg
gaaaagatgaggcagtctcttcctatgcagtggttacatagacctcttttagagggaaga
ttgagtttgaattatgaatgtttcaaaacagattttaaggaacaggacataaagacactt
cccagccatttgtgtacttcagcattattgagcaaaatggtcttaattgcactgagaaag
gaaacagtcttagaaaataatgagcttgagaaaataattgcagaactgctttattcactg
cagtggtgtgaagaattagataacccacctatttttctaattggattttgtgaaatactt
caaaaaatgaatattacgtatgataacttacgtgtacttggtaatacgtcgggccttttg
cagctgttatttaacaggtccagagaacatggcacactgtggtctcttattattgctaag
ttgatcctttcccgaagcatttcatctgatgaagtaaaaccacattataagagaaaagaa
agtttttttccactaactgaaggcaatttgcataccattcaaagtctatgtccatttttg
tcaaaagaagaaaagaaagaatttagtgctcaatgtatacctgctcttttgggctggact
aagaaagatctttgcagcactaatggaggttttggacatcttgccattttcaattcttgt
ctgcaaaccaaaagtatagatgatggagagctattacatggaatattaaaaatcataata
tcctggaagaaagagcatgaagatatttttcttttcagttgtaatctatcagaagcaagt
ccagaggtactgggtgtaaatatagaaataatccggtttctttccctatttctgaaatac
tgctcatcccctttggcagagagtgagtgggacttcatcatgtgctccatgttggcttgg
ttggagacaacaagtgagaatcaggcattgtattctattccacttgtgcaactgtttgcc
tgtgtcagctgtgatttggcctgtgacctcagtgctttctttgattccacaactctggat
accattggcaatcttcctgtaaatctaatcagtgaatggaaagaatttttttcccaaggc
atccacagtttgcttttacctattttggtgactgttacaggagaaaacaaagatgtgtct
gaaacatcctttcagaatgcaatgctgaaacccatgtgtgaaacattaacgtatatctca
aaggaacagctattgagtcacaaacttcctgcaagattagttgctgaccaaaaaacaaac
ttaccagaatatctccagactttgttaaatacattggccccattactcctcttcagagct
aggcctgtgcaaattgctgtttatcatatgctatacaaattgatgcctgaattaccacag
tatgatcaggataatctaaagtcatacggagatgaagaagaagagccagccttgtcacca
ccagcagcactgatgtctcttcttagcattcaagaggacttactagaaaatgttttgggg
tgtattcctgttggacagatagttactattaaaccactgagtgaagacttctgttatgtt
ctgggataccttctcacttggaaattaatactaactttcttcaaagctgcatcatcacag
cttcgggctttgtattccatgtatcttcggaaaacaaagagtttgaataaattgctctat
cacctgttcaggcttatgccagaaaatccaacctatgcagagacagcagttgaggtccca
aataaggaccctaaaacattctttactgaggagctccagctgagtattagagaaacaaca
atgcttccataccacattccacacttggcttgttcagtctatcatatgacattaaaagac
ttgcctgccatggttaggttgtggtggaatagcagtgagaagcgtgttttcaatattgtg
gatagatttacaagcaagtatgtcagcagtgttctttcttttcaagaaatatcttctgta
caaacaagtacacaactatttaatggcatgacggttaaagctcgagctactactcgagag
gtaatggctacttatactattgaggacatagttattgaacttataatacaactgccttca
aattatccactgggttcaataatagtagaaagtgggaaaagagtaggagtagctgttcag
cagtggcggaactggatgctgcagttaagcacttacctcacccatcagaatggaagtatt
atggaaggcttagctttatggaaaaataacgtagacaaacgttttgagggtgttgaagat
tgcatgatctgtttctcagtcattcacggtttcaactattcccttcccaaaaaagcctgt
agaacatgcaagaaaaaattccattcagcctgcttgtacaaatggtttacatctagcaac
aaatccacttgtccactgtgtcgtgagacgtttttctga

DBGET integrated database retrieval system