KEGG   Homo sapiens (human): 26050Help
Entry
26050             CDS       T01001                                 

Gene name
SLITRK5, LRRC11, bA364G4.2
Definition
(RefSeq) SLIT and NTRK like family member 5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT LRR_1 GRP
Motif
Other DBs
NCBI-GeneID: 26050
NCBI-ProteinID: NP_056382
OMIM: 609680
HGNC: 20295
Ensembl: ENSG00000165300
Vega: OTTHUMG00000017167
Pharos: O94991(Tbio)
UniProt: O94991
Position
13q31.2
AA seq 958 aa AA seqDB search
MHTCCPPVTLEQDLHRKMHSWMLQTLAFAVTSLVLSCAETIDYYGEICDNACPCEEKDGI
LTVSCENRGIISLSEISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASILHLGSNVIQDI
ETGAFHGLRGLRRLHLNNNKLELLRDDTFLGLENLEYLQVDYNYISVIEPNAFGKLHLLQ
VLILNDNLLSSLPNNLFRFVPLTHLDLRGNRLKLLPYVGLLQHMDKVVELQLEENPWNCS
CELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRRLISDYEMRPQTPL
STTGYLHTTPASVNSVATSSSAVYKPPLKPPKGTRQPNKPRVRPTSRQPSKDLGYSNYGP
SIAYQTKSPVPLECPTACSCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENY
IAVVRRTDFLEATGLDLLHLGNNRISMIQDRAFGDLTNLRRLYLNGNRIERLSPELFYGL
QSLQYLFLQYNLIREIQSGTFDPVPNLQLLFLNNNLLQAMPSGVFSGLTLLRLNLRSNHF
TSLPVSGVLDQLKSLIQIDLHDNPWDCTCDIVGMKLWVEQLKVGVLVDEVICKAPKKFAE
TDMRSIKSELLCPDYSDVVVSTPTPSSIQVPARTSAVTPAVRLNSTGAPASLGAGGGASS
VPLSVLILSLLLVFIMSVFVAAGLFVLVMKRRKKNQSDHTSTNNSDVSSFNMQYSVYGGG
GGTGGHPHAHVHHRGPALPKVKTPAGHVYEYIPHPLGHMCKNPIYRSREGNSVEDYKDLH
ELKVTYSSNHHLQQQQQPPPPPQQPQQQPPPQLQLQPGEEERRESHHLRSPAYSVSTIEP
REDLLSPVQDADRFYRGILEPDKHCSTTPAGNSLPEYPKFPCSPAAYTFSPNYDLRRPHQ
YLHPGAGDSRLREPVLYSPPSAVFVEPNRNEYLELKAKLNVEPDYLEVLEKQTTFSQF
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgcacacttgctgccccccagtaactttggaacaggaccttcacagaaaaatgcatagc
tggatgctgcagactctagcgtttgctgtaacatctctcgtcctttcgtgtgcagaaacc
atcgattattatggggaaatctgtgacaatgcatgtccttgtgaggaaaaggacggcatt
ttaactgtgagctgtgaaaaccgggggatcatcagtctctctgaaattagccctccccgt
ttcccaatctaccacctcttgttgtccggaaaccttttgaaccgtctctatcccaatgag
tttgtcaattacactggggcttcaattttgcatctaggtagcaatgttatccaggacatt
gagaccggggctttccatgggctacggggtttgaggagattgcatctaaacaataataaa
ctggaacttctgcgagatgataccttccttggcttggagaacctggagtacctacaggtc
gattacaactacatcagcgtcattgaacccaatgcttttgggaaactgcatttgttgcag
gtgcttatcctcaatgacaatcttttgtccagtttacccaacaatcttttccgttttgtg
cccttaacgcacttggacctccgggggaaccggctgaaacttctgccctacgtggggctc
ttgcagcacatggataaagttgtggagctacagctggaggaaaacccttggaattgttct
tgtgagctgatctctctaaaggattggttggacagcatctcctattcagccctggtgggg
gatgtagtttgtgagacccccttccgcttacacggaagggacttggacgaggtatccaag
caggaactttgcccaaggagacttatttctgactacgagatgaggccgcagacgcctttg
agcaccacggggtatttacacaccaccccggcgtcagtgaattctgtggccacttcttcc
tctgctgtttacaaaccccctttgaagccccctaaggggactcgccaacccaacaagccc
agggtgcgccccacctctcggcagccctctaaggacttgggctacagcaactatggcccc
agcatcgcctatcagaccaaatccccggtgcctttggagtgtcccaccgcgtgctcttgc
aacctgcagatctctgatctgggcctcaacgtaaactgccaggagcgaaagatcgagagc
atcgctgaactgcagcccaagccctacaatcccaagaaaatgtatctgacagagaactac
atcgctgtcgtgcgcaggacagacttcctggaggccacggggctggacctcctgcacctg
gggaataaccgcatctcgatgatccaggaccgcgctttcggggatctcaccaacctgagg
cgcctctacctgaatggcaacaggatcgagaggctgagcccggagttattctatggcctg
cagagcctgcagtatctcttcctccagtacaatctcatccgcgagattcagtctggaact
tttgacccggtcccaaacctccagctgctattcttgaataacaacctcctgcaggccatg
ccctcaggcgtcttctctggcttgaccctcctcaggctaaacctgaggagtaaccacttc
acctccttgccagtgagtggagttttggaccagctgaagtcactcatccaaatcgacctg
catgacaatccttgggattgtacctgtgacattgtgggcatgaagctgtgggtggagcag
ctcaaagtgggcgtcctagtggacgaggtgatctgtaaggcgcccaaaaaattcgctgag
accgacatgcgctccattaagtcggagctgctgtgccctgactattcagatgtagtagtt
tccacgcccacaccctcctctatccaggtccctgcgaggaccagcgccgtgactcctgcg
gtccggttgaatagcaccggggcccccgcgagcttgggcgcaggcggaggggcgtcgtcg
gtgcccttgtctgtgttaattctcagcctcctgctggttttcatcatgtccgtcttcgtg
gccgccgggctcttcgtgctggtcatgaagcgcaggaagaagaaccagagcgaccacacc
agcaccaacaactccgacgtgagctcctttaacatgcagtacagcgtgtacggcggcggc
ggcggcacgggcggccacccacacgcgcacgtgcatcaccgcgggcccgcgctgcccaag
gtgaagacgcccgcgggccacgtgtatgaatacatcccccacccactgggccacatgtgc
aaaaaccccatctaccgctcccgagagggcaactccgtagaggattacaaagacctgcac
gagctcaaggtcacctacagcagcaaccaccacctgcagcagcagcagcagccgccgccg
ccaccgcagcagccacagcagcagcccccgccgcagctgcagctgcagcccggggaggag
gagaggcgggaaagccaccacttgcggagccccgcctacagcgtcagcaccatcgagccc
cgggaggacctgctgtcgccggtgcaggacgccgaccgcttttacaggggcattttagaa
ccagacaaacactgctccaccacccccgccggcaatagcctcccggaatatcccaaattc
ccgtgcagccccgctgcttacactttctcccccaactatgacctgagacgcccccatcag
tatttgcacccgggggcaggggacagcaggctacgggaaccggtgctctacagccccccg
agtgctgtctttgtagaacccaaccggaacgaatatctggagttaaaagcaaaactaaac
gttgagccggactacctcgaagtgctggaaaaacagaccacgtttagccagttctaa

DBGET integrated database retrieval system