KEGG   Homo sapiens (human): 26054Help
Entry
26054             CDS       T01001                                 

Gene name
SENP6, SSP1, SUSP1
Definition
(RefSeq) SUMO specific peptidase 6
  KO
K08595  sentrin-specific protease 6 [EC:3.4.22.68]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    26054 (SENP6)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    26054 (SENP6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.68  Ulp1 peptidase
     26054 (SENP6)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C48: Ulp1 endopeptidase family
   26054 (SENP6)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   26054 (SENP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C48
Motif
Other DBs
NCBI-GeneID: 26054
NCBI-ProteinID: NP_056386
OMIM: 605003
HGNC: 20944
Ensembl: ENSG00000112701
Vega: OTTHUMG00000015060
Pharos: Q9GZR1(Tbio)
UniProt: Q9GZR1 B3KMM0
Position
6q14.1
AA seq 1112 aa AA seqDB search
MAAGKSGGSAGEITFLEALARSESKRDGGFKNNWSFDHEEESEGDTDKDGTNLLSVDEDE
DSETSKGKKLNRRSEIVANSSGEFILKTYVRRNKSESFKTLKGNPIGLNMLSNNKKLSEN
TQNTSLCSGTVVHGRRFHHAHAQIPVVKTAAQSSLDRKERKEYPPHVQKVEINPVRLSRL
QGVERIMKKTEESESQVEPEIKRKVQQKRHCSTYQPTPPLSPASKKCLTHLEDLQRNCRQ
AITLNESTGPLLRTSIHQNSGGQKSQNTGLTTKKFYGNNVEKVPIDIIVNCDDSKHTYLQ
TNGKVILPGAKIPKITNLKERKTSLSDLNDPIILSSDDDDDNDRTNRRESISPQPADSAC
SSPAPSTGKVEAALNENTCRAERELRSIPEDSELNTVTLPRKARMKDQFGNSIINTPLKR
RKVFSQEPPDALALSCQSSFDSVILNCRSIRVGTLFRLLIEPVIFCLDFIKIQLDEPDHD
PVEIILNTSDLTKCEWCNVRKLPVVFLQAIPAVYQKLSIQLQMNKEDKVWNDCKGVNKLT
NLEEQYIILIFQNGLDPPANMVFESIINEIGIKNNISNFFAKIPFEEANGRLVACTRTYE
ESIKGSCGQKENKIKTVSFESKIQLRSKQEFQFFDEEEETGENHTIFIGPVEKLIVYPPP
PAKGGISVTNEDLHCLNEGEFLNDVIIDFYLKYLVLEKLKKEDADRIHIFSSFFYKRLNQ
RERRNHETTNLSIQQKRHGRVKTWTRHVDIFEKDFIFVPLNEAAHWFLAVVCFPGLEKPK
YEPNPHYHENAVIQKCSTVEDSCISSSASEMESCSQNSSAKPVIKKMLNKKHCIAVIDSN
PGQEESDPRYKRNICSVKYSVKKINHTASENEEFNKGESTSQKVADRTKSENGLQNESLS
STHHTDGLSKIRLNYSDESPEAGKMLEDELVDFSEDQDNQDDSSDDGFLADDNCSSEIGQ
WHLKPTICKQPCILLMDSLRGPSRSNVVKILREYLEVEWEVKKGSKRSFSKDVMKGSNPK
VPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQE
DQSKEKRKHKDTYSTEAPLGEGTEQYVNSISD
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggcaagagcggcggtagcgcaggggagattacttttctggaagctttggct
agatcagagtctaagagagatggaggttttaaaaataattggagctttgatcatgaagaa
gaaagtgaaggagatacagataaagatgggacaaatctgctcagtgtggatgaagatgag
gattctgaaacctcaaaaggaaaaaagttaaatcgtcgatctgaaattgttgctaatagc
tctggtgaattcatcttgaagacatatgtaagacgaaacaagtctgaaagttttaaaact
ttgaaaggcaacccaattggacttaacatgttgagcaacaataagaaattgagtgaaaat
acgcaaaatacgtcattatgttctggaactgtagttcatggtagacgttttcatcatgct
catgcacagataccagtagtaaaaacagcagcccaaagcagtctggaccgaaaagaaagg
aaagaatacccacctcatgtccaaaaagttgaaattaatcctgtaaggttaagtcggctc
caaggtgttgaacgtataatgaagaaaacagaagagtccgaatcacaagtggagcctgaa
attaagaggaaagtacaacagaaacgacactgtagtacctatcagcctactcctcctcta
tctcctgcttcaaaaaaatgtttaacccatttagaggatttgcaaagaaattgcagacaa
gctattactttgaatgagtctactggaccattattaagaacgtcaattcatcagaattct
ggaggacagaagtcacaaaacacaggattaacaaccaagaagttttatggcaacaatgtg
gaaaaggttccaattgatattattgtgaattgtgatgacagtaaacacacttatttacag
actaatggaaaagtcattttacctggggcaaaaatacccaaaatcacaaacttgaaagaa
aggaaaacaagtttgtcagacctaaatgatccaatcattttgtccagtgatgatgatgat
gacaacgacagaactaacagaagagaaagcatatctcctcagcctgctgattcagcatgt
tcttcccctgcaccatccactggaaaagtagaagcagcgctaaatgaaaatacttgcaga
gcagagcgtgaactacgaagcattccagaagactcagagttaaatacagttacattgcca
agaaaagcaagaatgaaagaccagtttggcaattctattatcaacacacctctgaaacgt
cgtaaagtgttttctcaagaacctccagatgctttagctttaagctgccaaagttccttt
gacagtgtcattttaaactgtcgaagtatacgagtaggaacactcttccggctgttaata
gagcctgtaattttttgtttagattttatcaagatacagctagacgaaccagaccatgat
cctgtagagattatattaaatacctctgatctaactaaatgtgaatggtgtaatgtccga
aaattacctgtagtgtttcttcaagcaattccagcagtttatcaaaagctgagcatccaa
ctgcaaatgaataaggaggataaagtttggaatgattgtaaaggagtaaataaattaaca
aatttagaagaacaatatataattttaatttttcaaaatggccttgatcctccggcaaat
atggtatttgaaagtatcattaatgaaattggtataaagaataacatctccaattttttt
gcgaaaattccctttgaagaagctaatggcagacttgttgcctgtacaagaacctatgaa
gagagcatcaaaggaagttgtgggcaaaaggaaaacaaaattaaaactgtatcatttgaa
tctaaaatacaacttagaagcaaacaagaatttcagttttttgatgaagaagaagaaact
ggagaaaaccacaccatcttcattggcccagtagaaaagttgatagtatatccaccacct
ccagctaagggaggcatctctgttaccaatgaggacctgcactgtctaaatgaaggagaa
tttttaaatgatgttattatagacttttatttgaaatacttggtgcttgaaaaactgaag
aaggaagacgctgaccgaattcatatattcagttcttttttctataaacgccttaatcag
agagagaggagaaatcatgaaacaactaatctgtcaatacagcaaaaacggcatgggaga
gtaaaaacatggacccggcacgtagatatttttgagaaggattttatttttgtacccctt
aatgaagctgcacactggtttttggctgttgtttgtttccccggtttggaaaaaccaaag
tatgaacctaatcctcattaccatgaaaatgctgtcatacagaaatgttcaactgtagag
gacagttgtatttcttcttcagccagtgaaatggagagttgttcacaaaactcttctgcc
aagcctgtaattaagaagatgctaaacaaaaaacattgcatagctgtaattgattccaat
cctgggcaggaagaaagtgaccctcgttataagagaaacatatgcagtgtaaaatacagt
gtgaaaaaaataaatcatactgcgagtgaaaatgaagaattcaataaaggagaatctaca
tcccagaaagttgctgataggactaaaagtgagaatggcctacagaatgaaagtttaagt
tccacacatcatacagatggcttaagcaaaatcagactaaactatagcgatgaatcacct
gaagctggtaaaatgcttgaagatgaactcgtcgacttctcagaagatcaggataaccag
gatgatagcagtgacgatggattcctcgctgatgacaactgcagttcagaaataggacag
tggcatttaaagcctactatctgtaaacaaccttgtatcctacttatggactcactccga
ggcccttctcggtcaaatgttgtcaaaattttaagagagtatttagaagtggaatgggaa
gttaaaaaaggaagcaaaagaagtttttccaaagatgttatgaagggctctaatccaaaa
gtaccacagcaaaacaacttcagtgactgtggtgtatatgtattgcagtatgtagagagc
ttttttgagaatccaattctcagttttgaactacctatgaatttggcaaactggtttcct
ccaccaagaatgagaacaaaaagagaagaaatccgaaacataattctgaagctacaggaa
gatcagagcaaagagaaaagaaagcataaggacacttactcaacagaagcacctttaggc
gaaggaacagaacaatatgtcaatagtatctcagattga

DBGET integrated database retrieval system