KEGG   Homo sapiens (human): 26056Help
Entry
26056             CDS       T01001                                 

Gene name
RAB11FIP5, GAF1, RIP11, pp75
Definition
(RefSeq) RAB11 family interacting protein 5
  KO
K12484  Rab11 family-interacting protein 1/2/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    26056 (RAB11FIP5)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    26056 (RAB11FIP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 RBD-FIP
Motif
Other DBs
NCBI-GeneID: 26056
NCBI-ProteinID: NP_056285
OMIM: 605536
HGNC: 24845
Ensembl: ENSG00000135631
Vega: OTTHUMG00000129779
Pharos: Q9BXF6(Tbio)
UniProt: Q9BXF6 Q9UFM0
Position
2p13.2
AA seq 653 aa AA seqDB search
MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQVGREKYSTSVV
EKTHGCPEWREECSFELPPGALDGLLRAQEADAGPAPWAASSAAACELVLTTMHRSLIGV
DKFLGQATVALDEVFGAGRAQHTQWYKLHSKPGKKEKERGEIEVTIQFTRNNLSASMFDL
SMKDKPRSPFSKIRDKMKGKKKYDLESASAILPSSAIEDPDLGSLGKMGKAKGFFLRNKL
RKSSLTQSNTSLGSDSTLSSASGSLAYQGPGAELLTRSPSRSSWLSTEGGRDSAQSPKLF
THKRTYSDEANQMRVAPPRALLDLQGHLDAASRSSLCVNGSHIYNEEPQGPVRHRSSISG
SLPSSGSLQAVSSRFSEEGPRSTDDTWPRGSRSNSSSEAVLGQEELSAQAKVLAPGASHP
GEEEGARLPEGKPVQVATPIVASSEAVAEKEGARKEERKPRMGLFHHHHQGLSRSELGRR
SSLGEKGGPILGASPHHSSSGEEKAKSSWFGLREAKDPTQKPSPHPVKPLSAAPVEGSPD
RKQSRSSLSIALSSGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHL
THDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPPK
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggccctggtgcggggcgcggagccggcggcggggccttcccgctggctgcccacgcac
gtccaggtgacggtgctgcgggcccgcgggctgcggggcaagagctcgggagcgggcagc
accagcgacgcgtacacggtgatccaggtgggccgcgagaagtacagtacgtcggtggtg
gagaagacgcacggctgccccgagtggcgtgaggagtgctccttcgagctgccgccgggg
gccctggatggcctgctgcgggcgcaggaggccgacgcgggcccggcgccctgggccgcg
agctccgccgccgcctgcgagctggtgctcaccaccatgcaccgctcgctcatcggcgtc
gacaagttcctgggccaggccacggtggcgctggacgaggtcttcggcgcaggccgcgcc
cagcacacgcagtggtacaagctgcactccaagccaggcaagaaggagaaggaacgcggc
gagattgaagtcaccatccagttcacgcgcaacaacctgagcgccagtatgtttgacctg
tccatgaaggacaagccaaggtctcccttcagcaagatcagggacaagatgaagggcaag
aagaagtatgatctggaatctgcctctgccatcctcccaagcagcgccatagaggatcct
gacctgggcagcctgggcaagatgggcaaagccaaaggcttcttcctccgcaacaagctg
cgcaagtcgtccctgacccagtccaacacctcgctgggctcggacagcaccctgtcctca
gccagcgggagcttggcctaccagggacctggcgccgaactcctcacccgctcaccaagc
cgtagcagctggctgtccactgaagggggcagggactctgcacagtcccccaagctgttc
acccataagaggacctacagcgatgaggccaaccagatgcgagtggctcctcctcgggcc
cttctggaccttcagggccacctggatgctgcctcccgctcttcgctctgtgtcaatggg
agccacatttacaatgaggagccccagggccctgtgcggcaccgcagctccatctcgggc
tcgcttccatcctctggctccttgcaagctgtctcttcccggttctccgaggaggggcct
cgttccacagatgacacctggcccagaggcagtcgtagcaacagcagctcagaggcagtg
cttggacaggaggagctgagtgctcaggctaaagtcctggcccctggggccagccaccct
ggagaggaggagggggcccggctaccagagggcaagccagtccaggttgccacacccata
gtggcctcctctgaggctgtggcagagaaggagggagcccggaaggaggaacgcaagccc
cggatgggtctcttccaccaccaccaccaaggcctaagtcggagcgagttgggtcgccga
agctctctgggggaaaaggggggtcccatcctgggggcctccccacatcactcatccagt
ggggaggaaaaggccaagagtagctggtttggcttgagagaagccaaggacccgactcag
aaacccagtccccaccccgtgaagcccctcagtgccgcccctgtggagggcagccccgac
aggaagcagtcccgctccagtctgagcatagccctgagcagtgggctggagaagctcaaa
acagtcacatctgggagcattcagcctgtgacccaggccccccaggctggccagatggtg
gacaccaaaaggctgaaggactcagctgtgctggaccagtcggccaagtactaccacctg
acccacgatgagctcatcagcctgctcctgcagcgggagcgggagctgagccagcgggac
gagcatgtgcaggagctggagagctacatcgaccggctgctggtgcggatcatggagacc
tcacccacgctgctgcagatccccccgggcccccccaaatag

DBGET integrated database retrieval system