KEGG   Homo sapiens (human): 26058Help
Entry
26058             CDS       T01001                                 

Gene name
GIGYF2, GYF2, PARK11, PERQ2, PERQ3, TNRC15
Definition
(RefSeq) GRB10 interacting GYF protein 2
  KO
K18730  PERQ amino acid-rich with GYF domain-containing protein
Organism
hsa  Homo sapiens (human)
Disease
H00057  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    26058 (GIGYF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     26058 (GIGYF2)
   Surveillance factors
    Other surveillance  factors
     26058 (GIGYF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GYF GYF_2 PRTase_3
Motif
Other DBs
NCBI-GeneID: 26058
NCBI-ProteinID: NP_001096616
OMIM: 612003
HGNC: 11960
Ensembl: ENSG00000204120
Vega: OTTHUMG00000153237
Pharos: Q6Y7W6(Tchem)
UniProt: Q6Y7W6
Structure
PDB: 

Position
2q37.1
AA seq 1299 aa AA seqDB search
MAAETQTLNFGPEWLRALSSGGSITSPPLSPALPKYKLADYRYGREEMLALFLKDNKIPS
DLLDKEFLPILQEEPLPPLALVPFTEEEQRNFSMSVNSAAVLRLTGRGGGGTVVGAPRGR
SSSRGRGRGRGECGFYQRSFDEVEGVFGRGGGREMHRSQSWEERGDRRFEKPGRKDVGRP
NFEEGGPTSVGRKHEFIRSESENWRIFREEQNGEDEDGGWRLAGSRRDGERWRPHSPDGP
RSAGWREHMERRRRFEFDFRDRDDERGYRRVRSGSGSIDDDRDSLPEWCLEDAEEEMGTF
DSSGAFLSLKKVQKEPIPEEQEMDFRPVDEGEECSDSEGSHNEEAKEPDKTNKKEGEKTD
RVGVEASEETPQTSSSSARPGTPSDHQSQEASQFERKDEPKTEQTEKAEEETRMENSLPA
KVPSRGDEMVADVQQPLSQIPSDTASPLLILPPPVPNPSPTLRPVETPVVGAPGMGSVST
EPDDEEGLKHLEQQAEKMVAYLQDSALDDERLASKLQEHRAKGVSIPLMHEAMQKWYYKD
PQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVPFSPGPAPPP
HMGELDQERLTRQQELTALYQMQHLQYQQFLIQQQYAQVLAQQQKAALSSQQQQQLALLL
QQFQTLKMRISDQNIIPSVTRSVSVPDTGSIWELQPTASQPTVWEGGSVWDLPLDTTTPG
PALEQLQQLEKAKAAKLEQERREAEMRAKREEEERKRQEELRRQQEEILRRQQEEERKRR
EEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELL
RKQEEEAAKWAREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQ
QQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQSQATLSLAEIQKLEEERERQL
REEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQ
QQHQQPNRARNNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWD
DAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEKLLKLFQGVNKAQDGFTQWCE
QMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKA
NQQRQQQQLPQQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQS
GKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDY
NT seq 3900 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggaaacgcagacactgaactttgggcctgaatggctccgagctctgtccagt
ggtgggagtattacatcccctcctctttctccagcattgccgaagtataaattagcagat
tatcgttacggcagagaagaaatgttagcacttttccttaaagacaacaagataccttca
gaccttctggataaagaatttctgcctatcctccaggaggaaccccttccaccattggct
ctggtaccctttacagaagaagaacagagaaacttttccatgtctgtaaatagtgctgct
gtcctgcgattgacaggacgaggaggaggaggaacagtggtgggggctcctagaggtcga
agttcttcaagagggcgaggcagaggcagaggtgaatgtggtttctaccaaagaagtttt
gatgaagtagagggtgtttttggtcgaggaggtggcagagaaatgcatagatcgcagagc
tgggaggaaaggggtgacagacgttttgaaaaaccaggacgaaaagatgtagggagacca
aattttgaggaaggtggaccaacatcagtagggagaaagcatgaatttatacgctcagaa
agtgaaaattggcgcatctttagagaggaacaaaatggagaagatgaagatggaggttgg
cgactagctggatcaaggagggatggagagaggtggcgacctcacagtcctgatggccct
cgttctgcaggctggcgggaacacatggaacgacgtcggaggtttgagtttgattttcga
gatagagatgatgaacggggttaccgaagggttcgctctggcagtgggagcatagatgat
gacagggatagcttgcccgaatggtgcttagaggatgctgaagaagaaatgggtacattt
gactcatctggagcattcctttctctaaaaaaagtacagaaagagcctattccagaagag
caggagatggacttccggcctgtggacgaaggggaggagtgctctgactctgagggtagc
cataatgaagaggccaaagaacccgataagacaaataagaaagaaggagagaaaacagat
agagtaggagttgaagctagtgaggaaactccccagacctcatcatcatctgctagacca
ggtactccttcagaccatcagtctcaggaagcatcacagtttgagaggaaagatgaacca
aaaactgagcaaacggaaaaagctgaagaggagactcggatggaaaatagtctaccagcc
aaagtgcccagcagaggggatgaaatggttgctgatgtccagcagcccctgtcgcagatt
ccttcagatacagcctctcctcttctcatacttccacctcctgttcccaatcctagtcct
actctccggccagttgaaacaccagttgtaggtgctcctggtatgggcagtgtttccaca
gaacctgatgatgaagaaggtctcaaacatttggagcagcaagctgagaaaatggtggct
tatctccaagacagtgcactagatgatgaaagattggcatcaaaactgcaagagcacaga
gctaaaggagtgtcgattccattgatgcatgaagcaatgcagaagtggtattacaaagat
cctcagggagaaattcaaggtcccttcaataatcaggagatggcagaatggtttcaggcg
ggctattttactatgtctttattggtgaagagagcgtgtgatgaaagcttccaacctctt
ggcgatatcatgaaaatgtggggaagggttcccttttctccaggtccagctccccctcct
catatgggagagctggaccaggaacgactgaccaggcagcaagaactcacagccttatac
cagatgcagcacctgcagtaccagcagtttttaatacaacaacaatatgcacaggttttg
gcccaacagcagaaagcagcactgtcttcccagcagcagcagcagttggcacttcttctt
caacagtttcagaccttgaagatgagaatatctgatcagaacatcattccctcagtaact
aggtctgtgtccgtgccagatactggctctatctgggagcttcagccaacagcttcacag
cctacagtttgggaaggtggtagtgtatgggatcttcctctggacaccacgacaccaggc
cctgccctggaacagcttcagcagctagagaaggccaaagctgcaaagctagagcaagag
agaagagaggcagaaatgagggcaaaacgggaagaggaagagcgaaagaggcaggaagaa
ctccgaagacaacaggaggaaattcttcggcgacagcaggaagaagaaaggaaaaggcga
gaggaagaagaacttgcccgaaggaaacaggaagaggctctgcgtcgccagcgggagcaa
gaaattgcattaaggcgacagcgagaagaggaagaaagacagcagcaagaagaagctctt
agaagactggaagagaggagaagagaagaggaagaaaggcggaagcaggaagaattgtta
cgcaaacaggaagaggaggctgcaaaatgggcccgggaagaagaagaagcccagcgtcga
ttagaggagaaccggctgcggatggaagaggaggcagccagactccggcatgaggaagaa
gaacggaagagaaaggagctggaggtccagcggcagaaggagttaatgcgccagaggcag
cagcagcaagaggctctccggaggttgcagcagcagcagcagcaacaacagctggcgcag
atgaagcttccttcttcttcaacgtggggccagcagtccaatacaacagcatgtcagtcc
caggccacgctgtcgttggctgaaatccaaaaactagaggaagaacgagaacggcagctt
cgagaagagcaaaggcgccagcagagggagttgatgaaagctcttcagcagcagcagcaa
cagcaacagcagaaactctcaggttgggggaatgtcagcaaaccttcaggtaccacgaaa
tctcttctggagatccagcaggaagaggccaggcaaatgcaaaagcagcagcagcagcag
cagcaacaccagcaaccaaacagagctcgtaacaatacgcattccaacctgcacaccagc
attgggaattctgtttggggctctataaatactggtcctcctaaccagtgggcatctgac
ctagtcagtagtatttggagtaatgctgacactaaaaactccaacatgggattctgggat
gatgcagtgaaagaggtgggacctaggaattcaacaaataaaaataaaaacaacgccagt
ctcagtaaatctgtaggtgtgtctaaccggcagaataagaaagtagaagaagaagaaaag
ttgctgaagctctttcagggagtaaataaagcccaagatggatttacgcagtggtgtgaa
cagatgcttcatgcccttaatacggcaaataacttggatgttcccacatttgtttctttc
ctgaaagaagtagaatctccttatgaggtccatgattatatcagggcctatttaggagat
acttctgaggccaaggagtttgccaagcagttccttgagcgccgtgccaaacagaaagcc
aaccagcagcgtcagcagcagcagctgccacagcagcagcagcagcagccgccacagcag
ccgccacagcagccacaacagcaggactctgtgtgggggatgaaccacagtacactccat
tcagtatttcagaccaatcaaagcaacaaccaacaatccaattttgaggctgtgcagagt
ggcaagaagaagaaaaagcagaagatggtccgagcagatcccagtttattaggattttca
gtcaatgcatcatcggagcgactcaacatgggtgaaatcgagacgttggatgactactga

DBGET integrated database retrieval system