KEGG   Homo sapiens (human): 26059Help
Entry
26059             CDS       T01001                                 

Gene name
ERC2, CAST, CAST1, ELKSL, SPBC110, Spc110
Definition
(RefSeq) ELKS/RAB6-interacting/CAST family member 2
  KO
K19878  ELKS/RAB6-interacting/CAST family member 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26059 (ERC2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Others
   Others
    26059 (ERC2)
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    26059 (ERC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cast PKcGMP_CC AAA_13 ATG16 Lebercilin
Motif
Other DBs
NCBI-GeneID: 26059
NCBI-ProteinID: NP_056391
OMIM: 617250
HGNC: 31922
Ensembl: ENSG00000187672
Vega: OTTHUMG00000158390
Pharos: O15083(Tbio)
UniProt: O15083
Position
3p14.3
AA seq 957 aa AA seqDB search
MYGSARTITNLEGSPSRSPRLPRSPRLGHRRTSSGGGGGTGKTLSMENIQSLNAAYATSG
PMYLSDHEGVASTTYPKGTMTLGRATNRAVYGGRVTAMGSSPNIASAGLSHTDVLSYTDQ
HGGLTGSSHHHHHQVPSMLRQVRDSTMLDLQAQLKELQRENDLLRKELDIKDSKLGSSMN
SIKTFWSPELKKERVLRKEEAARMSVLKEQMRVSHEENQHLQLTIQALQDELRTQRDLNH
LLQQESGNRGAEHFTIELTEENFRRLQAEHDRQAKELFLLRKTLEEMELRIETQKQTLNA
RDESIKKLLEMLQSKGLPSKSLEDDNERTRRMAEAESQVSHLEVILDQKEKENIHLREEL
HRRSQLQPEPAKTKALQTVIEMKDTKIASLERNIRDLEDEIQMLKANGVLNTEDREEEIK
QIEVYKSHSKFMKTKIDQLKQELSKKESELLALQTKLETLSNQNSDCKQHIEVLKESLTA
KEQRAAILQTEVDALRLRLEEKESFLNKKTKQLQDLTEEKGTLAGEIRDMKDMLEVKERK
INVLQKKIENLQEQLRDKDKQLTNLKDRVKSLQTDSSNTDTALATLEEALSEKERIIERL
KEQRERDDRERLEEIESFRKENKDLKEKVNALQAELTEKESSLIDLKEHASSLASAGLKR
DSKLKSLEIAIEQKKEECSKLEAQLKKAHNIEDDSRMNPEFADQIKQLDKEASYYRDECG
KAQAEVDRLLEILKEVENEKNDKDKKIAELESLTLRHMKDQNKKVANLKHNQQLEKKKNA
QLLEEVRRREDSMADNSQHLQIEELMNALEKTRQELDATKARLASTQQSLAEKEAHLANL
RIERRKQLEEILEMKQEALLAAISEKDANIALLELSASKKKKTQEEVMALKREKDRLVHQ
LKQQTQNRMKLMADNYDDDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQDDEEGIWA
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaagtgcaagaacaatcaccaatctggaaggtagcccttccagatcccctcgt
ttgccaaggtctcctcgtttgggccaccgaagaacaagtagtgggggaggtggaggaaca
ggcaagactctgtctatggagaatatccagtccctcaatgcagcctatgctacgtctgga
cccatgtatctgagtgatcatgaaggggtggcttcaacaacctacccaaagggcactatg
actctgggaagggctacaaatcgagctgtatatggaggccgtgtcacagccatggggagt
agtcccaatattgcttctgctggactttcccacacagatgtcctttcatacacagatcaa
catggtgggctgactggctcatcccatcatcaccaccaccaggtcccctccatgttgagg
caggtaagagacagcacaatgttagatcttcaggcccagctgaaagaactgcagagagag
aatgacctcctccggaaagagctagacatcaaggacagcaaattgggatcttccatgaac
agtattaagactttctggagtcctgagcttaagaaggagagagtcttgaggaaagaagag
gcagcgcggatgtctgtcctcaaggagcagatgagggtttcccatgaagaaaatcagcac
ctacagttgacaatccaggcccttcaagatgagctgcgaacccagagagacctcaaccac
ctcctccagcaagagagtggcaaccgaggagcggagcacttcaccatcgagctgaccgag
gagaactttaggcggctccaagccgagcatgacaggcaggctaaggagctgttccttttg
aggaagacattagaggaaatggagctgagaattgaaacgcagaaacaaaccctcaatgcc
cgagatgagtcaattaaaaaacttcttgagatgttgcaaagtaaaggcttgccatccaaa
agcctggaggatgacaatgagcgaacgcggcggatggcagaggctgagtctcaggtcagc
cacttggaagtgattttagatcagaaagagaaggaaaacatacatcttagagaggaattg
caccgaagaagccaacttcagccggagccagccaagacgaaggctctccagactgtcatc
gaaatgaaggacacaaaaatcgcttcattggaacgaaacataagggatcttgaggatgag
atccagatgttaaaagccaatggtgtgctgaacactgaggaccgcgaagaagagatcaaa
caaattgaggtttacaaaagtcactccaagtttatgaagaccaagattgatcagctgaag
caggaactttcaaagaaagagtcggaacttcttgccttacaaacaaagcttgaaaccctc
agcaatcaaaattcagattgcaagcaacacattgaagtgctcaaagagtcacttactgcc
aaagaacagagggctgccatccttcagactgaggtagatgcgctgagattacgactggaa
gaaaaagaatctttcctcaataaaaaaacaaaacagctacaggacctcacagaagagaag
gggacactggccggtgaaattcgtgacatgaaagatatgttagaagtgaaggaaagaaaa
atcaatgttcttcagaaaaagattgaaaacttgcaagaacaacttagggataaagacaag
caactgaccaacctgaaagacagagtgaagtccttgcagacggattccagtaatacagat
actgcactggcgacgctagaggaagctctgtcagagaaggagagaataattgagcgcttg
aaagaacagcgagaaagagatgatcgggaaagactagaagagatagaatccttccgaaaa
gagaacaaagacctgaaagagaaggtcaatgctttacaggctgaactgactgagaaagag
tctagtttaattgacctcaaagaacatgcatcttcattagcctctgcggggctgaaaagg
gattccaaattaaaatctctagaaatagccattgaacaaaagaaagaggaatgtagcaaa
ttggaagcacagttaaaaaaggcacataatattgaagatgactccaggatgaaccctgag
tttgcagaccaaataaaacagctcgataaagaggcgtcttactaccgcgacgagtgtggc
aaggcccaagcggaagtggaccggttgctggagatcctcaaggaggtggagaatgagaag
aatgacaaggacaagaagatcgcagaactggagagcttgactctcaggcatatgaaagat
cagaataagaaggtggccaacctcaagcacaatcaacagttggaaaagaagaaaaatgct
cagttactagaagaagtgcgcaggcgagaagacagcatggctgacaactcacagcatttg
cagatagaggaactgatgaatgcactggagaagaccagacaggaactggatgccaccaaa
gcacgcctcgcctccacacaacagtccctggccgaaaaagaagcgcacttggccaacctc
cggattgagaggaggaaacagctggaggagatcctggagatgaaacaggaagcactactt
gcagccatcagtgaaaaagatgcaaacattgccttgctggaattgtctgcctccaaaaag
aaaaagacgcaggaagaagtcatggccctcaagcgggaaaaagaccgactagtacatcaa
ttaaagcagcagacccagaacagaatgaagttgatggcagacaactatgatgatgaccat
caccattaccaccaccaccaccatcaccaccaccatcgatctcctgggaggtcgcaacat
tccaatcacaggccctctccggaccaggatgacgaggagggcatatgggcatag

DBGET integrated database retrieval system