KEGG   Homo sapiens (human): 26060Help
Entry
26060             CDS       T01001                                 

Gene name
APPL1, APPL, DIP13alpha, MODY14
Definition
(RefSeq) adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1
  KO
K08733  DCC-interacting protein 13 alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04211  Longevity regulating pathway
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
Network
nt06231  Apoptosis
nt06260  Colorectal cancer
  Element
N00101  DCC-apoptotic pathway
N00102  Loss of DCC to DCC-apoptotic pathway
Disease
H00410  Maturity onset diabetes of the young (MODY)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    26060 (APPL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    26060 (APPL1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    26060 (APPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26060 (APPL1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    26060 (APPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR_3 PID PH BAR PH_9
Motif
Other DBs
NCBI-GeneID: 26060
NCBI-ProteinID: NP_036228
OMIM: 604299
HGNC: 24035
Ensembl: ENSG00000157500
Vega: OTTHUMG00000133756
Pharos: Q9UKG1(Tbio)
UniProt: Q9UKG1
Structure
PDB: 

Position
3p14.3
AA seq 709 aa AA seqDB search
MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHL
TSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKE
RDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMH
YFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREM
DSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQ
FYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESK
KDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPAAGQSRP
PTARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTN
PFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRM
TESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLS
SVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIE
KDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESEA
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgccggggatcgacaagctgcccatcgaggagacgctggaggacagcccgcagacaagg
tctttactaggtgtatttgaagaagatgccacagctatttccaactatatgaaccagttg
tatcaagctatgcatcggatttatgatgcacagaatgaattaagtgcagcaacacacctg
acctcaaaacttttaaaagaatatgaaaaacagcgttttccattgggaggtgatgatgaa
gttatgagctctacattgcaacagttttcaaaagttatagatgagcttagctcttgtcat
gcagtgctttcaactcaacttgctgatgccatgatgttccccattacccagtttaaagaa
agagatctgaaagaaatactaacattaaaggaagtatttcagattgcaagtaatgatcat
gatgctgcgattaatagatatagccgtttatcaaaaaaaagagaaaatgacaaggtgaag
tatgaagtaacagaagatgtgtacacatccagaaagaaacaacaccagaccatgatgcat
tatttttgtgcattaaatactcttcagtacaagaagaaaatagcattgttagaacctcta
cttgggtacatgcaagctcagataagtttctttaagatgggttctgaaaatcttaatgaa
caactggaagaatttttagctaatattggaacaagcgttcagaatgttcgcagggaaatg
gacagtgatatagagaccatgcaacagacaatagaggatttggaagtagccagtgatccc
ttatatgtgcctgacccagaccccaccaaatttcctgttaatcgaaatttaacccgaaag
gctggataccttaatgctaggaataaaacaggcttggtgtcatctacctgggacagacag
ttttacttcacgcagggtggaaatttaatgagtcaggcccgtggggatgtagcaggaggc
ctggccatggacatagacaactgttcagtgatggctgtggactgtgaagacagacgatat
tgttttcagatcacctctttcgatggaaaaaaatcttcaattttgcaagcagagagtaaa
aaagatcatgaagagtggatctgtacaataaacaacatatctaaacaaatatacttaagt
gaaaatccagaggaaactgctgcacgagtaaatcaatcagctctggaagctgtcactcct
tccccatctttccagcagaggcacgagagcctgcggccagcagcaggacaatctcggcca
ccgacagctcgaaccagcagttcaggatccttaggatctgagtctacaaatttggctgcc
ctctctctagattctcttgttgccccagacaccccaatacagtttgacataatttctcct
gtgtgtgaagatcagcctggccaggcaaaagcctttggccagggaggcaggcgtacaaat
ccatttggagaatctggaggaagtacaaaatctgaaactgaagattctattcttcatcag
ttatttattgtccgattccttggttcaatggaggtgaaatcagatgaccatccagatgtt
gtttatgaaactatgcgccaaatcttagctgcccgggccatccataacatctttcgtatg
acagaatcgcatttattagtcacttgtgactgtttaaagttaattgatccacagacacaa
gttacaaggctcacgtttccattaccttgtgtagttttgtatgctacacaccaggaaaat
aagcgcctttttggatttgttcttcggacatcaagcgggagaagtgaaagtaatctgtca
tcagtctgctatatatttgagtcaaacaatgagggggaaaagatatgtgattctgttgga
ctggcaaaacagatagctttgcatgctgaactggatcgtagggcatcagaaaaacaaaaa
gaaatagagagagtaaaagagaagcaacagaaagaactcaataaacaaaaacagattgaa
aaggacttggaagaacaaagtcggttgatagctgcttccagtagaccaaaccaagccagt
agtgaggggcagtttgttgtccttagcagtagccagtcagaagagagtgatttgggagaa
ggaggaaagaagagagaatcagaagcataa

DBGET integrated database retrieval system